Product Details

Purity

≥ 95% as determined by SDS-PAGE.
≥ 95% as determined by SEC-HPLC.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized human IL12RB1 at 2 μg/mL can bind Anti-IL12RB1 recombinant antibody(CSB-RA011588MA1HU). The EC50 is 1.578-2.143 ng/mL.

Target Names

IL12RB1

Uniprot No.

P42701

Alternative Names

IL12R, IL12RB

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

24-540aa

Target Protein Sequence

CRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRTLHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTEPVALNISVGTNGTTMYWPARAQSMTYCIEWQPVGQDGGLATCSLTAPQDPDPAGMATYSWSRESGAMGQEKCYYITIFASAHPEKLTLWSTVLSTYHFGGNASAAGTPHHVSVKNHSLDSVSVDWAPSLLSTCPGVLKEYVVRCRDEDSKQVSEHPVQPTETQVTLSGLRAGVAYTVQVRADTAWLRGVWSQPQRFSIE

Mol. Weight

58.5 kDa

Protein Length

Partial

Tag Info

C-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

IL-12 receptor signaling drives Th1 differentiation and IFN-γ production, making IL12RB1 a critical node in cell-mediated immunity and a target for immunomodulatory therapeutics. This mammalian-expressed construct spanning residues 24–540 captures the extracellular ligand-binding domain with native glycosylation patterns that preserve conformational epitopes, as demonstrated by functional ELISA showing dose-dependent antibody binding with an EC50 of 1.578–2.143 ng/mL. The quantified binding kinetics support use in therapeutic antibody epitope mapping, competitive inhibition screening to identify blocking candidates, and SPR or BLI affinity characterization of IL-12/IL12RB1 interactions relevant to autoimmune and inflammatory disease models. Purity exceeding 95% by SDS-PAGE and endotoxin below 1.0 EU/μg meet the quality thresholds commonly required for receptor-ligand interaction assays and antibody validation workflows in immunology research.

Target Background

Function

Functions as an interleukin receptor which binds interleukin-12 with low affinity and is involved in IL12 transduction. Associated with IL12RB2 it forms a functional, high affinity receptor for IL12. Associates also with IL23R to form the interleukin-23 receptor which functions in IL23 signal transduction probably through activation of the Jak-Stat signaling cascade.

Gene References into Functions

A novel IL12RB1 N-terminal signal peptide stop-gain loss-of-function homozygous genotype connects three unrelated Brazilian kindreds with IL-12Rbeta1 deficiency with varying severity and early-onset age mainly regarding susceptibility to Mycobacteria, Histoplasma, and Salmonella infections through the paradoxical diminished cell-surface expression of an impaired IL-12Rbeta1 polypeptide. PMID: 28450854
To our knowledge, this is the third patient with Mendelian susceptibility to mycobacterial disease due to IL-12Rbeta1 deficiency complicated with enteropathy and hypogammaglobulinemia and the first case of this disease to be described in Colombia. PMID: 28865061
Th17 cells expressed consistent high levels of the IL-12Rbeta1 subunit, which appeared a better predictor of responsiveness to IL-23 than the expression of the IL-23R subunit. PMID: 27645493
Truncated IL12rbeta1/Fc is a novel fusion protein for specific binding multiple forms of p40 subunit to exert potent anti-inflammatory effects. PMID: 26384304
the introduction of RNA-DNA differences into an individual's IL12RB1 mRNA repertoire is a novel determinant of IL12/23 sensitivity. PMID: 26621740
we describe cosegregation of a heterozygous germline defect in IL12RB1 and gastric cancer development in a family with IL-12Rbeta1 deficiency PMID: 25467645
individual variability in IL12RB1 function is introduced at the epigenetic, genomic polymorphism, and mRNA splicing levels [review] PMID: 25516297
Early coupled up-regulation of IL12RB1 in CD8+ central memory and effector T cells result in better clinical outcomes in liver transplant recipients. PMID: 25603847
Strong association of rs438421 in the IL-12Rbeta1 gene with Allergic rhinitis in Chinese was demonstrated . The GG genotype of rs438421 was validated as stimulus factors to AR, while the AG genotype of rs438421 was confirmed as protective factors to AR. PMID: 24997981
The IL-23/IL-23R/IL-12Rbeta1 complex formation does not follow the classical "site I-II-III" architectural paradigm. PMID: 25371211
IL-12Rbeta1 expression on the cell surface was negligible or absent. PMID: 23952477
SNP rs2305743 in IL12RB1 was associated with systemic sclerosis. PMID: 25199642
A review of the molecular genetics of all known IL12RB1 mutations and variants. PMID: 23864330
IL12Rbeta1 expression is lacking on CD8+ T and natural killer (NK) cell surface in a 33-year-old patient with Mycobacterium tilburgii infection. PMID: 24114017
Results suggest a relationship between certain TNF-alpha and IL12B polymorphisms and the short-term response to anti-TNF-alpha drugs. PMID: 23662788
Although SNPs of the IL12RB1 gene do not seem to convey some genetic predisposition for hidradenitis suppurativa, they impact considerably on the clinical phenotype of the disease. PMID: 23557799
IL12RB1 is located on autosomal chromosome 19 at location 19p13.1 and comprises exons 1-9, 9b, and 10-17. IL12RB1 isoform 2 is distinct from isoform 1 and is derived from alternate 3' exon inclusion. PMID: 23024274
IL12RB1 polymorphisms may affect IL-12 and IL-23 binding and downstream effects, which are critical cytokines in the cell-mediated immune response to measles vaccine. PMID: 22504412
Our data suggest that the effect of breast-feeding on food sensitization (FS) was modified by SNPs in the IL12RB1, TLR9, and TSLP genes both individually and jointly. PMID: 21689850
first cases in Mexico of patients with BCG disease traced to a mutation in the IL12RB1 gene, with a fatal outcome PMID: 20171917
autosomal recessive IL12Rbeta1 deficiency who suffered from sepsis attributable to Klebsiella pneumoniae. PMID: 20855390
Coupled regulation of interleukin-12 receptor beta-1 of CD8+ central memory and CCR7-negative PMID: 20345976
rs438421 (IVS12+1266T/C) SNP and the haplotype CCA (rs375947, rs438421, and rs1870063) significantly associated with atopic dermatitis PMID: 20060272
A splice acceptor mutation affecting exon 15 of the IL-12R beta 1 subunit gene results in complete loss of surface expression of this subunit, and impairment of memory CD4 T cells with Th1 effector function. PMID: 12496448
Severe Mycobacterium bovis BCG infections in a large series of novel IL-12 receptor beta1 deficient patients and evidence for the existence of partial IL-12 receptor beta1 deficiency. PMID: 12594833
These data suggest that the R214-T365-R378 allele, i.e., variation in IL12RB1, contribute to tuberculosis susceptibility in the Japanese population. PMID: 12596048
impact of amino acid variations on the three-dimensional structure of the IL-12Rbeta1 protein PMID: 12671732
surface expression of nonfunctional IL-12Rbeta1 is related to an IL12RB1 mutation PMID: 15178580
IL12RB1 polymorphisms might influence the risk of development of pulmonary tuberculosis in adults PMID: 15243935
Interleukin-12 receptor beta 1 codon 378 gene polymorphism is not correlated with endometriosis development. PMID: 16084898
In individuals with the -111T/T genotype, reduced IL-12Rbeta1 expression may lead to increased Th2 cytokine production in the skin and contribute to the development of Atopic dermatitis and other subsequent allergic diseases. PMID: 16159888
Genetic variants of IL12RB1, at least in part, confer genetic susceptibility to TB, and are associated with the progression of the disease, in Japanese. PMID: 17284226
IL12B promoter heterozygosity was associated with protection from tuberculosis in BCG-vaccinated individuals, supporting the role that IL-23, of which IL12B encodes a subunit, plays in generation of memory T cells PMID: 17392024
A twofold increase in the percentage of CD4-resting T cells expressing IL-12Rbeta1 and IL-18Ralpha from HIV-1-infected patients; deregulation of the IL-12 and IL-18 pathways may play a role in the immunopathogenesis of HIV-1 infection. PMID: 17403771
data indicate that genetic variants of IL12RB1confer genetic susceptibility to SARS infection, but not necessary associated with the progression of the disease in Chinese population PMID: 18478121
IL-12Rbeta1 gene polymorphisms do not appear to be responsible for host susceptibility to nontuberculous mycobacterial lung disease in a Korean population. PMID: 18493823
IL-12Rbeta1- and STAT-3--dependent signals play a key role in the differentiation and/or expansion of human IL-17-producing T cell populations in vivo. PMID: 18591412
analysis of a known (c.1623_1624delGCinsTT) and a novel mutation (c.65_68delCTGC of exon2) of the Interleukin-12 Receptor-beta1 gene in a patient with a fatal case of relapsing cervical lymphadenopathy due to Mycobacterium avium [case report] PMID: 18940359
A common haplotype spanning 1.45-3.51Mb was shared by all chromosomes carrying mutation 1623_1624delinsTT, an IL12RB1 mutation, which results in Mendelian Susceptibility to Mycobacterial Diseases; mutation was not detected on 100 control chromosomes. PMID: 19460324
novel nonsense mutation in exon 4 results in protein deficiency and increased susceptibility to bacterial infections PMID: 19839503

Hide All

Involvement in disease

Immunodeficiency 30 (IMD30)

Subcellular Location

Membrane; Single-pass type I membrane protein.

Protein Families

Type I cytokine receptor family, Type 2 subfamily

Database Links

HGNC: 5971

OMIM: 601604

KEGG: hsa:3594

STRING: 9606.ENSP00000403103

UniGene: Hs.567294

Code	CSB-MP011588HU3
Abbreviation	Recombinant Human IL12RB1 protein, partial (Active)
MSDS	MSDS Datasheet
Size	$9.9
Promotion
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized human IL12RB1 at 2 μg/ml can bind Anti-IL12RB1 recombinant antibody(CSB-RA011588MA1HU). The EC₅₀ is 1.578-2.143 ng/mL. Biological Activity Assay The purity of IL12RB1 was greater than 95% as determined by SEC-HPLC
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Interleukin-12 receptor subunit beta-1(IL12RB1),partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage