Recombinant Human Interleukin-12 receptor subunit beta-1(IL12RB1),partial (Active)

In Stock
Code CSB-MP011588HU3
Abbreviation Recombinant Human IL12RB1 protein, partial (Active)
MSDS
Size $118
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156 Biological Activity Assay
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Promotion
20% OFF Promotion on CUSABIO Premium Active Proteins
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized human IL12RB1 at 2 μg/mL can bind Anti-IL12RB1 recombinant antibody(CSB-RA011588MA1HU). The EC50 is 1.578-2.143 ng/mL.
Target Names
Uniprot No.
Alternative Names
IL12R, IL12RB
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
24-540aa
Target Protein Sequence
CRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRTLHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTEPVALNISVGTNGTTMYWPARAQSMTYCIEWQPVGQDGGLATCSLTAPQDPDPAGMATYSWSRESGAMGQEKCYYITIFASAHPEKLTLWSTVLSTYHFGGNASAAGTPHHVSVKNHSLDSVSVDWAPSLLSTCPGVLKEYVVRCRDEDSKQVSEHPVQPTETQVTLSGLRAGVAYTVQVRADTAWLRGVWSQPQRFSIE
Mol. Weight
58.5 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This recombinant human IL12RB1 protein is an active, high-quality product expressed in mammalian cells to preserve native conformation and post-translational modifications. Spanning amino acids 24 to 540 of the human IL12RB1 sequence, it is engineered with a C-terminal 10xHis tag for straightforward purification and detection. Supplied as a lyophilized powder, the recombinant IL12RB1 protein boasts a purity exceeding 95%, verified independently by both SDS-PAGE and SEC-HPLC. Endotoxin levels are tightly controlled, measuring under 1.0 EU/µg as confirmed by LAL testing. Functional performance was validated in ELISA assays, where the immobilized protein at 2 μg/mL effectively binds the anti-IL12RB1 recombinant antibody (CSB-RA011588MA1HU), with an EC50 between 1.578 and 2.143 ng/mL. These characteristics confirm the IL12RB1 protein's reliability and functionality in immunological or receptor-binding research applications.

IL12RB1 serves a pivotal function in the immune system by mediating the effects of IL-12, which is crucial for the differentiation of T cells into a type 1 helper (Th1) cell response. This receptor subunit, alongside its partner IL12RB2, forms a heterodimer that constitutes the high-affinity receptor for IL-12 on T and natural killer (NK) cells [1][2][3]. The binding of IL-12 to its receptor initiates a cascade of intracellular signals that are essential for producing the proinflammatory cytokine interferon-gamma (IFN-γ), thereby shaping the body's immune response towards a Th1 profile, which is essential for combating intracellular pathogens, such as Mycobacterium tuberculosis and Listeria monocytogenes [4][5].

Mutations or polymorphisms in the IL12RB1 gene can lead to significant immunological consequences. Homozygous recessive mutations obstruct the surface expression of the IL-12 receptor, which results in compromised IFN-γ secretion from T and NK cells, thereby impairing the immune response against various infections [1][6]. For instance, individuals with IL-12Rβ1 deficiency display an increased susceptibility to mycobacterial infections, underscoring the critical role of this receptor in protective immunity [7][6]. A study by Beaucoudrey et al. highlighted the association between gene mutations in IL12RB1 and increased vulnerability to non-tuberculous mycobacterial infections, illustrating the pivotal role of IL-12 signaling in host defense mechanisms [6].

The overall functionality of IL12RB1 is also highlighted in various genetic studies, indicating that different polymorphisms can be linked to autoimmune and infectious diseases, such as rheumatoid arthritis, tuberculosis, and even severe acute respiratory syndrome [2][8]. The relationship between IL-12 receptor signaling and Th1-mediated immune responses further emphasizes the importance of IL12RB1 in maintaining immune system balance and responding to infections effectively [3][9].

Furthermore, IL-12 not only stimulates cellular immunity but also has a role in linking innate and adaptive immune responses, making the IL-12/IL-12R axis fundamental in immunotherapy approaches as well as vaccine strategies. It has been shown that therapeutic applications leveraging the IL-12 pathway can enhance immune responses against various malignancies and infections, thereby highlighting the therapeutic potential of modulating this pathway [5][10].

References:
[1] K. Kusuhara, K. Yamamoto, K. Okada, Y. Mizuno, & T. Hara. Association of il12rb1 polymorphisms with susceptibility to and severity of tuberculosis in japanese: a gene‐based association analysis of 21 candidate genes. International Journal of Immunogenetics, vol. 34, no. 1, p. 35-44, 2007. https://doi.org/10.1111/j.1744-313x.2007.00653.x
[2] T. Tabone and G. Morahan. Definition of polymorphisms in the gene encoding the interleukin-12 receptor b1 subunit: testing linkage disequilibrium with type i diabetes susceptibility. Genes and Immunity, vol. 4, no. 3, p. 222-227, 2003. https://doi.org/10.1038/sj.gene.6363948
[3] B. Brattinga, A. Rutgers, et al. Preoperative inflammatory markers as a predictor of three-year overall survival in older cancer patients undergoing oncologic surgery. Cancers, vol. 13, no. 8, p. 1824, 2021. https://doi.org/10.3390/cancers13081824
[4] G. Orozco, M. González‐Gay, et al. Interleukin 12 (il12b) and interleukin 12 receptor (il12rb1) gene polymorphisms in rheumatoid arthritis. Human Immunology, vol. 66, no. 6, p. 710-714, 2005. https://doi.org/10.1016/j.humimm.2005.02.004
[5] G. Davis, L. Pfeiffer, D. Hemenway, & M. Rincón. Interleukin-12 is not essential for silicosis in mice. Particle and Fibre Toxicology, vol. 3, no. 1, 2006. https://doi.org/10.1186/1743-8977-3-2
[6] L. Beaucoudrey, A. Samarina, et al. Revisiting human il-12rβ1 deficiency Medicine, vol. 89, no. 6, p. 381-402, 2010. https://doi.org/10.1097/md.0b013e3181fdd832
[7] T. Sakai, M. Matsuoka, M. Aoki, K. Nosaka, & H. Mitsuya Missense mutation of the interleukin-12 receptor β1 chain–encoding gene is associated with impaired immunity againstmycobacterium avium complex infection. Blood, vol. 97, no. 9, p. 2688-2694, 2001. https://doi.org/10.1182/blood.v97.9.2688
[8] F. Tang, W. Liu, et al. Il-12 rb1 genetic variants contribute to human susceptibility to severe acute respiratory syndrome infection among chinese Plos One, vol. 3, no. 5, p. e2183, 2008. https://doi.org/10.1371/journal.pone.0002183
[9] L. Zhang, D. Prather, et al. Polymorphisms in genes of interleukin 12 and its receptors and their association with protection against severe malarial anaemia in children in western kenya. Malaria Journal, vol. 9, no. 1, 2010. https://doi.org/10.1186/1475-2875-9-87
[10] Y. Liu, N. Egilmez, & M. Russell. Enhancement of adaptive immunity to neisseria gonorrhoeae by local intravaginal administration of microencapsulated interleukin 12. The Journal of Infectious Diseases, vol. 208, no. 11, p. 1821-1829, 2013. https://doi.org/10.1093/infdis/jit354

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Functions as an interleukin receptor which binds interleukin-12 with low affinity and is involved in IL12 transduction. Associated with IL12RB2 it forms a functional, high affinity receptor for IL12. Associates also with IL23R to form the interleukin-23 receptor which functions in IL23 signal transduction probably through activation of the Jak-Stat signaling cascade.
Gene References into Functions
  1. A novel IL12RB1 N-terminal signal peptide stop-gain loss-of-function homozygous genotype connects three unrelated Brazilian kindreds with IL-12Rbeta1 deficiency with varying severity and early-onset age mainly regarding susceptibility to Mycobacteria, Histoplasma, and Salmonella infections through the paradoxical diminished cell-surface expression of an impaired IL-12Rbeta1 polypeptide. PMID: 28450854
  2. To our knowledge, this is the third patient with Mendelian susceptibility to mycobacterial disease due to IL-12Rbeta1 deficiency complicated with enteropathy and hypogammaglobulinemia and the first case of this disease to be described in Colombia. PMID: 28865061
  3. Th17 cells expressed consistent high levels of the IL-12Rbeta1 subunit, which appeared a better predictor of responsiveness to IL-23 than the expression of the IL-23R subunit. PMID: 27645493
  4. Truncated IL12rbeta1/Fc is a novel fusion protein for specific binding multiple forms of p40 subunit to exert potent anti-inflammatory effects. PMID: 26384304
  5. the introduction of RNA-DNA differences into an individual's IL12RB1 mRNA repertoire is a novel determinant of IL12/23 sensitivity. PMID: 26621740
  6. we describe cosegregation of a heterozygous germline defect in IL12RB1 and gastric cancer development in a family with IL-12Rbeta1 deficiency PMID: 25467645
  7. individual variability in IL12RB1 function is introduced at the epigenetic, genomic polymorphism, and mRNA splicing levels [review] PMID: 25516297
  8. Early coupled up-regulation of IL12RB1 in CD8+ central memory and effector T cells result in better clinical outcomes in liver transplant recipients. PMID: 25603847
  9. Strong association of rs438421 in the IL-12Rbeta1 gene with Allergic rhinitis in Chinese was demonstrated . The GG genotype of rs438421 was validated as stimulus factors to AR, while the AG genotype of rs438421 was confirmed as protective factors to AR. PMID: 24997981
  10. The IL-23/IL-23R/IL-12Rbeta1 complex formation does not follow the classical "site I-II-III" architectural paradigm. PMID: 25371211
  11. IL-12Rbeta1 expression on the cell surface was negligible or absent. PMID: 23952477
  12. SNP rs2305743 in IL12RB1 was associated with systemic sclerosis. PMID: 25199642
  13. A review of the molecular genetics of all known IL12RB1 mutations and variants. PMID: 23864330
  14. IL12Rbeta1 expression is lacking on CD8+ T and natural killer (NK) cell surface in a 33-year-old patient with Mycobacterium tilburgii infection. PMID: 24114017
  15. Results suggest a relationship between certain TNF-alpha and IL12B polymorphisms and the short-term response to anti-TNF-alpha drugs. PMID: 23662788
  16. Although SNPs of the IL12RB1 gene do not seem to convey some genetic predisposition for hidradenitis suppurativa, they impact considerably on the clinical phenotype of the disease. PMID: 23557799
  17. IL12RB1 is located on autosomal chromosome 19 at location 19p13.1 and comprises exons 1-9, 9b, and 10-17. IL12RB1 isoform 2 is distinct from isoform 1 and is derived from alternate 3' exon inclusion. PMID: 23024274
  18. IL12RB1 polymorphisms may affect IL-12 and IL-23 binding and downstream effects, which are critical cytokines in the cell-mediated immune response to measles vaccine. PMID: 22504412
  19. Our data suggest that the effect of breast-feeding on food sensitization (FS) was modified by SNPs in the IL12RB1, TLR9, and TSLP genes both individually and jointly. PMID: 21689850
  20. first cases in Mexico of patients with BCG disease traced to a mutation in the IL12RB1 gene, with a fatal outcome PMID: 20171917
  21. autosomal recessive IL12Rbeta1 deficiency who suffered from sepsis attributable to Klebsiella pneumoniae. PMID: 20855390
  22. Coupled regulation of interleukin-12 receptor beta-1 of CD8+ central memory and CCR7-negative PMID: 20345976
  23. rs438421 (IVS12+1266T/C) SNP and the haplotype CCA (rs375947, rs438421, and rs1870063) significantly associated with atopic dermatitis PMID: 20060272
  24. A splice acceptor mutation affecting exon 15 of the IL-12R beta 1 subunit gene results in complete loss of surface expression of this subunit, and impairment of memory CD4 T cells with Th1 effector function. PMID: 12496448
  25. Severe Mycobacterium bovis BCG infections in a large series of novel IL-12 receptor beta1 deficient patients and evidence for the existence of partial IL-12 receptor beta1 deficiency. PMID: 12594833
  26. These data suggest that the R214-T365-R378 allele, i.e., variation in IL12RB1, contribute to tuberculosis susceptibility in the Japanese population. PMID: 12596048
  27. impact of amino acid variations on the three-dimensional structure of the IL-12Rbeta1 protein PMID: 12671732
  28. surface expression of nonfunctional IL-12Rbeta1 is related to an IL12RB1 mutation PMID: 15178580
  29. IL12RB1 polymorphisms might influence the risk of development of pulmonary tuberculosis in adults PMID: 15243935
  30. Interleukin-12 receptor beta 1 codon 378 gene polymorphism is not correlated with endometriosis development. PMID: 16084898
  31. In individuals with the -111T/T genotype, reduced IL-12Rbeta1 expression may lead to increased Th2 cytokine production in the skin and contribute to the development of Atopic dermatitis and other subsequent allergic diseases. PMID: 16159888
  32. Genetic variants of IL12RB1, at least in part, confer genetic susceptibility to TB, and are associated with the progression of the disease, in Japanese. PMID: 17284226
  33. IL12B promoter heterozygosity was associated with protection from tuberculosis in BCG-vaccinated individuals, supporting the role that IL-23, of which IL12B encodes a subunit, plays in generation of memory T cells PMID: 17392024
  34. A twofold increase in the percentage of CD4-resting T cells expressing IL-12Rbeta1 and IL-18Ralpha from HIV-1-infected patients; deregulation of the IL-12 and IL-18 pathways may play a role in the immunopathogenesis of HIV-1 infection. PMID: 17403771
  35. data indicate that genetic variants of IL12RB1confer genetic susceptibility to SARS infection, but not necessary associated with the progression of the disease in Chinese population PMID: 18478121
  36. IL-12Rbeta1 gene polymorphisms do not appear to be responsible for host susceptibility to nontuberculous mycobacterial lung disease in a Korean population. PMID: 18493823
  37. IL-12Rbeta1- and STAT-3--dependent signals play a key role in the differentiation and/or expansion of human IL-17-producing T cell populations in vivo. PMID: 18591412
  38. analysis of a known (c.1623_1624delGCinsTT) and a novel mutation (c.65_68delCTGC of exon2) of the Interleukin-12 Receptor-beta1 gene in a patient with a fatal case of relapsing cervical lymphadenopathy due to Mycobacterium avium [case report] PMID: 18940359
  39. A common haplotype spanning 1.45-3.51Mb was shared by all chromosomes carrying mutation 1623_1624delinsTT, an IL12RB1 mutation, which results in Mendelian Susceptibility to Mycobacterial Diseases; mutation was not detected on 100 control chromosomes. PMID: 19460324
  40. novel nonsense mutation in exon 4 results in protein deficiency and increased susceptibility to bacterial infections PMID: 19839503

Show More

Hide All

Involvement in disease
Immunodeficiency 30 (IMD30)
Subcellular Location
Membrane; Single-pass type I membrane protein.
Protein Families
Type I cytokine receptor family, Type 2 subfamily
Database Links

HGNC: 5971

OMIM: 601604

KEGG: hsa:3594

STRING: 9606.ENSP00000403103

UniGene: Hs.567294

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*