Recombinant Human Kidney-associated antigen 1 (KAAG1) (Active)

In Stock Promotion
Code CSB-EP871385HU
Abbreviation Recombinant Human KAAG1 protein (Active)
MSDS
Size $9.9
Promotion
CUSABIO Blowout: 4,100+ In-Stock Proteins
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human KAAG1 at 2μg/mL can bind Anti-KAAG1 recombinant antibody(CSB-RA871385MA1HU),the EC50 is 2.040-2.284 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human KAAG1 at 2 μg/mL can bind Anti-KAAG1 recombinant antibody(CSB-RA871385MA1HU). The EC50 is 2.040-2.284 ng/mL.
Target Names
Uniprot No.
Alternative Names
RU2AS
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-84aa
Target Protein Sequence
MDDDAAPRVEGVPVAVHKHALHDGLRQVAGPGAAAAHLPRWPPPQLAASRREAPPLSQRPHRTQGAGSPPETNEKLTNPQVKEK
Mol. Weight
15.9 kDa
Protein Length
Full Length
Tag Info
C-terminal 6xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant human KAAG1 Protein is a highly purified biological reagent expressed in Escherichia coli, comprising amino acid residues 1-84 of the full-length human KAAG1 sequence with a C-terminal 6xHis tag for efficient purification. Produced as a lyophilized powder, this recombinant KAAG1 protein demonstrates exceptional quality control parameters, exhibiting >90% purity as verified by SDS-PAGE analysis and containing <1.0 endotoxin units per microgram (EU/μg) when assessed through the LAL method. Functional characterization via ELISA reveals its strong binding capability to the anti-KAAG1 recombinant antibody (CSB-RA871385MA1HU), with an effective concentration for half-maximal response (EC50) ranging between 2.040 and 2.284 ng/mL when immobilized at 2 μg/mL. These biochemical and functional properties establish this engineered protein as a reliable tool for studying KAAG1-mediated biological processes, particularly in antibody interaction analyses and molecular binding assays requiring precise quantitation of protein- ligand interactions.

Human KAAG1 is a protein involved in various kidney-related conditions and physiological processes. As a protein expressed in normal kidneys, KAAG1 likely plays a role in cellular processes associated with kidney health, and it becomes particularly relevant in pathological situations such as acute kidney injury and glomerulonephritis.

KAAG1 has been linked to the immunogenicity observed in kidney transplantation contexts. Studies indicate that specific antigens, including KAAG1, can be recognized by antibodies in the serum of transplant recipients, potentially influencing graft rejection rates [1][2]. This relationship highlights the role of KAAG1 not only as a marker of renal tissue but also as part of the immunological environment surrounding kidney transplantation, where its expression can contribute to humoral immune responses critical in graft acceptance or rejection.

Moreover, the significance of KAAG1 extends into the realm of kidney disease, particularly regarding hepatitis B virus (HBV)-associated nephropathy. Research indicates that HBV infection can lead to kidney damage manifesting as glomerulonephritis, wherein KAAG1 may serve as an immunological target, possibly influencing the pathological mechanisms underlying HBV's effects on kidney structures [3][4].

The interaction of KAAG1 with various cellular processes adds complexity to its functional profile. Studies on acute kidney injury suggest that different signaling pathways may intersect with KAAG1 activity [5]. For instance, the epithelial cell response to injury is crucial, where KAAG1 may influence repair mechanisms or cell proliferation, indicating its potential integral role in both renal tissue integrity and the reparative process following injury.

Furthermore, understanding KAAG1's role in renal fibrosis and inflammation is essential, particularly as macrophage-derived microvesicles interplay with antigens like KAAG1 during renal inflammation, potentially modulating the disease state and influencing therapeutic approaches [6][7].

References:
[1] L. Li, T. Sigdel, M. Vitalone, S. Lee, & M. Sarwal. Differential immunogenicity and clinical relevance of kidney compartment specific antigens after renal transplantation. Journal of Proteome Research, vol. 9, no. 12, p. 6715-6721, 2010. https://doi.org/10.1021/pr1008674
[2] R. Dinavahi, A. George, et al. Antibodies reactive to non-hla antigens in transplant glomerulopathy. Journal of the American Society of Nephrology, vol. 22, no. 6, p. 1168-1178, 2011. https://doi.org/10.1681/asn.2010111183
[3] J. Zhang, X. Zhang, Y. Sun, B. Long, X. Wang, & X. Li. Reactivation of resolved hepatitis b virus infection combined with nephrotic syndrome in a patient after allogeneic haematopoietic stem cell transplantation. BMC Infectious Diseases, vol. 19, no. 1, 2019. https://doi.org/10.1186/s12879-019-3690-3
[4] T. Peng, T. Xie, L. Liu, J. Zhen, & X. Yang. Analysis of clinical features and pathology of serum hbsag positive glomerulonephritis. Journal of Medical Virology, vol. 90, no. 3, p. 612-615, 2017. https://doi.org/10.1002/jmv.24959
[5] J. Cao, B. Wang, et al. Exosomal mir-125b-5p deriving from mesenchymal stem cells promotes tubular repair by suppression of p53 in ischemic acute kidney injury. Theranostics, vol. 11, no. 11, p. 5248-5266, 2021. https://doi.org/10.7150/thno.54550
[6] A. Jackson, M. Kuperman, & R. Montgomery. Multiple hyperacute rejections in the absence of detectable complement activation in a patient with endothelial cell reactive antibody. American Journal of Transplantation, vol. 12, no. 6, p. 1643-1649, 2012. https://doi.org/10.1111/j.1600-6143.2011.03955.x
[7] T. Tang, L. Lv, et al. Employing macrophage-derived microvesicle for kidney-targeted delivery of dexamethasone: an efficient therapeutic strategy against renal inflammation and fibrosis. Theranostics, vol. 9, no. 16, p. 4740-4755, 2019. https://doi.org/10.7150/thno.33520

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*