Purity

≥ 90% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Human KAAG1 at 2 μg/mL can bind Anti-KAAG1 recombinant antibody(CSB-RA871385MA1HU). The EC50 is 4.924-6.034 ng/mL.

Target Names

KAAG1

Uniprot No.

Q9UBP8

Alternative Names

RU2AS

Species

Homo sapiens (Human)

Source

Baculovirus

Expression Region

1-84aa

Target Protein Sequence

MDDDAAPRVEGVPVAVHKHALHDGLRQVAGPGAAAAHLPRWPPPQLAASRREAPPLSQRPHRTQGAGSPPETNEKLTNPQVKEK

Mol. Weight

10.3 kDa

Protein Length

Full Length

Tag Info

C-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

KAAG1, a kidney-associated antigen implicated in renal cell carcinoma and other malignancies, remains challenging to produce in functional form due to its small size and potential aggregation. This full-length construct (aa 1–84) demonstrates robust antibody-binding activity with an EC50 of 4.924–6.034 ng/mL in functional ELISA, confirming proper folding and epitope accessibility essential for immunoassay development and antibody screening workflows. The baculovirus expression system yields protein exceeding 90% purity as determined by SDS-PAGE, with endotoxin levels below 1.0 EU/μg, meeting the quality thresholds commonly required for antibody validation studies, ELISA standard curve generation, and binding competition assays in cancer biomarker research. The C-terminal 10×His tag facilitates straightforward purification while preserving the native N-terminus critical for antibody recognition, making this reagent appropriate for developing diagnostic tools targeting KAAG1 in renal and other cancer contexts.

Code	CSB-BP871385HU
Abbreviation	Recombinant Human KAAG1 protein (Active)
MSDS	MSDS Datasheet
Size	$528
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Human KAAG1 at 2μg/mL can bind Anti-KAAG1 recombinant antibody(CSB-RA871385MA1HU)，the EC₅₀ is 4.924-6.034 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Kidney-associated antigen 1(KAAG1) (Active)

Product Details

Related Products

Customer Reviews and Q&A

×CloseMessage