Recombinant Human Tetraspanin-8 (TSPAN8)-VLPs (Active)

In Stock Promotion
Code CSB-MP025166HU
Abbreviation Recombinant Human TSPAN8 protein-VLPs (Active)
MSDS
Size $630
Order now
Promotion
20% OFF Promotion on CUSABIO Premium Active Proteins
Image
  • CSB-MP025166HU is detected by Mouse anti-6*His monoclonal antibody.(This tag can be tested only under denaturing conditions.)
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human TSPAN8 at 5 μg/ml can bind Anti-TSPAN8 recombinant antibody (CSB-RA025166MA1HU). The EC50 is 2.261-2.623 ng/mL.The VLPs (CSB-MP3838) is negative control. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Activity
Measured by its binding ability in a functional ELISA. Immobilized Human TSPAN8 at 5 μg/mL can bind Anti-TSPAN8 recombinant antibody (CSB-RA025166MA1HU). The EC50 is 2.261-2.623 ng/mL.The VLPs (CSB-MP3838) is negative control.
Target Names
Uniprot No.
Alternative Names
Transmembrane 4 superfamily member 3; Tumor-associated antigen CO-029
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
1-237aa
Target Protein Sequence
MAGVSACIKYSMFTFNFLFWLCGILILALAIWVRVSNDSQAIFGSEDVGSSSYVAVDILIAVGAIIMILGFLGCCGAIKESRCMLLLFFIGLLLILLLQVATGILGAVFKSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKDFLAKNLIIVIGISFGLAVIEILGLVFSMVLYCQIGNK
Mol. Weight
27.4 kDa
Protein Length
Full Length
Tag Info
C-terminal 10xHis-tagged(This tag can be tested only under denaturing conditions)
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
The VLPs are expressed from human 293 cells (HEK293).Mix the sample gently by repeatedly pipetting it up and down. Do not vortex.Repeated freezing and thawing is not recommended.Store the protein at -20°C/-80°C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity. The immunization strategy should be optimized (antigen dose, regimen and adjuvant).
Datasheet & COA
Please contact us to get it.
Description

The recombinant human TSPAN8 protein is a mammalian cell-expressed virus-like particle (VLP) presenting the full-length human TSPAN8 sequence spanning amino acids 1 to 237, with a C-terminal 10xHis tag facilitating purification. This lyophilized protein preparation exhibits functional activity as demonstrated by its ability to specifically bind the anti-TSPAN8 recombinant antibody (CSB-RA025166MA1HU) in ELISA assays, with an EC50 ranging from 2.261 to 2.623 ng/mL when immobilized at 5 μg/mL. The VLPs without TSPAN8 serve as negative controls. The VLP format preserves native-like conformation and membrane topology, enhancing the presentation of conformational epitopes for antibody recognition and functional studies. This recombinant TSPAN8 protein is valuable for investigating tetraspanin-mediated cellular processes and developing therapeutic antibodies targeting tumor-associated antigens.

Human TSPAN8, also known as TM4SF3, belongs to the tetraspanin superfamily, characterized by its four highly-conserved transmembrane domains and its involvement in various cellular processes, including cell proliferation, adhesion, and motility [1]. TSPAN8 is particularly noted for its role in cancer, having been identified as a tumor-associated antigen with elevated expression in multiple malignancies such as melanoma, pancreatic cancer, and colorectal cancer [2][3][4]. The overexpression of TSPAN8 has been correlated with increased metastatic potential and cancer progression [3][4].

TSPAN8 forms microdomains in the cell membrane, facilitating the lateral organization of proteins and interaction with various partners, including integrins [5][6]. This dynamic organization is critical for regulating multiple signaling pathways related to cell movement and growth [6][2]. For instance, TSPAN8 promotes invasive characteristics in melanoma cells by activating certain extracellular matrix-degrading enzymes, contributing to the protein's role in facilitating tumor invasion and metastasis [7][8].

Moreover, research has highlighted TSPAN8's potential as a prognostic marker in cancer. High expression levels of TSPAN8 have been linked to poor outcomes in various types of cancers, making it a candidate for targeted immunotherapy [9][10]. Studies indicate that TSPAN8 is instrumental in the recruitment of proteins into extracellular vesicles, which further influences intercellular communication and may play a role in the tumor microenvironment [11][12]. TSPAN8 also appears to cross-regulate with other signaling molecules, influencing cancer cell behavior under various physiological conditions [6][2][9].

References:
[1] O. Berthier‐Vergnes, M. Kharbili, et al. Gene expression profiles of human melanoma cells with different invasive potential reveal tspan8 as a novel mediator of invasion. British Journal of Cancer, vol. 104, no. 1, p. 155-165, 2010. https://doi.org/10.1038/sj.bjc.6605994
[2] M. Rodia, R. Solmi, et al. Lgals4, ceacam6, tspan8, and col1a2: blood markers for colorectal cancer—validation in a cohort of subjects with positive fecal immunochemical test result. Clinical Colorectal Cancer, vol. 17, no. 2, p. e217-e228, 2018. https://doi.org/10.1016/j.clcc.2017.12.002
[3] O. Berthier‐Vergnes, L. Barbollat‐Boutrand, et al. Tetraspanin8 expression predicts an increased metastatic risk and is associated with cancer-related death in human cutaneous melanoma. Molecular Cancer, vol. 20, no. 1, 2021. https://doi.org/10.1186/s12943-021-01429-0
[4] L. Li, D. Yang, et al. Quantitative proteomics analysis of the role of tetraspanin-8 in the drug resistance of gastric cancer. International Journal of Oncology, 2017. https://doi.org/10.3892/ijo.2017.4231
[5] L. Hysenaj, S. Little, et al. Sars-cov-2 infection of airway organoids reveals conserved use of tetraspanin-8 by ancestral, delta, and omicron variants. Stem Cell Reports, vol. 18, no. 3, p. 636-653, 2023. https://doi.org/10.1016/j.stemcr.2023.01.011
[6] I. Cheng, C. Caberto, et al. Type 2 diabetes risk variants and colorectal cancer risk: the multiethnic cohort and page studies. Gut, vol. 60, no. 12, p. 1703-1711, 2011. https://doi.org/10.1136/gut.2011.237727
[7] Y. Zhu, F. Tao, et al. Upregulation of tetraspanin 8 may contribute to lpsinduced acute lung injury by activation of the mapk and nf-κb pathways. Tropical Journal of Pharmaceutical Research, vol. 20, no. 9, p. 1833-1838, 2021. https://doi.org/10.4314/tjpr.v20i9.8
[8] M. Akiel, P. Santhekadur, R. Mendoza, A. Siddiq, P. Fisher, & D. Sarkar. Tetraspanin 8 mediates aeg‐1‐induced invasion and metastasis in hepatocellular carcinoma cells. Febs Letters, vol. 590, no. 16, p. 2700-2708, 2016. https://doi.org/10.1002/1873-3468.12268
[9] Z. Li, Y. Zhang, J. Pei, Z. Xu, H. Chen, & Y. Huang. Angiogenesis-related gene in cervical cancer identifies tumor microenvironment and expression signatures predicting prognosis. 2022. https://doi.org/10.21203/rs.3.rs-1973956/v1
[10] X. Lin, Z. Bi, et al. Tspan8 serves as a prognostic marker involving akt/mapk pathway in nasopharyngeal carcinoma. Annals of Translational Medicine, vol. 7, no. 18, p. 470-470, 2019. https://doi.org/10.21037/atm.2019.08.02
[11] J. Zhu, J. Zhang, X. Ji, Z. Tan, & D. Lubman. Column-based technology for cd9-hplc immunoaffinity isolation of serum extracellular vesicles. Journal of Proteome Research, vol. 20, no. 10, p. 4901-4911, 2021. https://doi.org/10.1021/acs.jproteome.1c00549
[12] Y. Liu, J. Fan, et al. Extracellular vesicle tetraspanin-8 level predicts distant metastasis in non–small cell lung cancer after concurrent chemoradiation. Science Advances, vol. 6, no. 11, 2020. https://doi.org/10.1126/sciadv.aaz6162

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Gene References into Functions
  1. TSPAN8 mediated Wnt/beta-catenin pathway through binding to NOTCH2. The role of TSPAN8 in the drug resistance of gastric cancer. PMID: 29345284
  2. these data point to a crucial role of Co-029 in the modulation of colon cancer cell motility which could be related to the protumoral effect reported for this tetraspanin. Among surface molecules able to mediate Co-029 function, E-cadherin, EGFR and CD44 appear as likely candidates. PMID: 28418857
  3. Single nucleotide polymorphism in TSPAN8 gene is associated with pathogenesis of bipolar disorder. PMID: 28777493
  4. Tetraspanin-8 has a role in promoting hepatocellular carcinoma metastasis by increasing ADAM12m expression PMID: 27270327
  5. LCMR1 modulation was sufficient to positively regulate endogenous Tspan8 expression, with concomitant in vitro phenotypic changes such as loss of melanoma cell-matrix adherence and increase in invasion, and Tspan8 expression promoted tumourigenicity in vivo. PMID: 27375018
  6. Data indicate a regulatory role for tetraspanin 8 (Tspan8) in melanoma progression by modulating cell-matrix interactions through beta1 integrin - integrin-linked kinase (ILK) axis and establish Tspan8 as a negative regulator of ILK activity. PMID: 28188308
  7. TSPAN8 might be important for the orchestration of meprin beta at the cell surface with impact on certain proteolytic processes PMID: 27180358
  8. Knocking down TSPAN8 in AEG-1-overexpressing human hepatocellular carcinoma (HCC) cells markedly inhibited invasion and migration without affecting proliferation. TSPAN8 knockdown profoundly abrogated AEG-1-induced primary tumor and intrahepatic metastasis in an orthopic xenograft model in athymic nude mice PMID: 27339400
  9. Knockdown and knockout models revealed that CD151 and Tspan8 act as molecular facilitators in wound healing, angiogenesis and tumor progression. [review] PMID: 28408484
  10. Results provide evidence that TSPAN8 may contribute to the pathogenesis of lung cancer by promoting cell viability and proliferation. PMID: 27996312
  11. TSPAN8 is involved in tumor progression and is an independent prognostic classifier in patients with gastric cancer. PMID: 25711980
  12. This novel nuclear localization of TM4SF3 depends on androgen-induced nuclear localization of androgen receptor (AR) in both androgen-dependent and androgen-independent prostate cancer cell lines PMID: 26649804
  13. Our data suggest that TSPAN8-LEL may play an important role in mCRC cell invasion, and that the antibody we have developed could be a useful tool for inhibiting the invasion of TSPAN8-expressing mCRCs. PMID: 26562525
  14. Based on nasopharyngeal TSPAN8 gene expression in readily available Nasopharyngeal aspirate samples , we can discriminate between severity of disease in Respiratory syncytial virus infected infants. PMID: 25261323
  15. Tspn8 was over-expressed in multiple clinical malignant glioma tissues, and its expression level correlated with the grade of tumors. PMID: 25680464
  16. CO-029 functions as a regulator of both cell-matrix and cell-cell adhesion. During colon cancer progression, CO-029 promotes cancer cell movement by deregulating cell adhesions. PMID: 22679508
  17. PMA-induced Tspan8-internalization promotes cell migration, but reduces matrix and cell adhesion. PMID: 20937409
  18. High TSPAN8 is associated with melanoma invasiveness. PMID: 21081927
  19. claudin-7-associated EpCAM is recruited into (tetraspanin-enriched membrane microdomains) and forms a complex with CO-029 and CD44v6 that facilitates metastasis formation PMID: 17579117
  20. overexpression of TM4SF3 in esophageal cancer conferred advantage to the invasion and metastasis of this destructive disease PMID: 18365756

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
Tetraspanin (TM4SF) family
Tissue Specificity
Gastric, colon, rectal, and pancreatic carcinomas.
Database Links

HGNC: 11855

OMIM: 600769

KEGG: hsa:7103

STRING: 9606.ENSP00000247829

UniGene: Hs.170563

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*