Product Details

Activity

Measured by its binding ability in a functional ELISA. Immobilized Human TSPAN8 at 5 μg/mL can bind Anti-TSPAN8 recombinant antibody (CSB-RA025166MA1HU). The EC50 is 2.261-2.623 ng/mL.The VLPs (CSB-MP3838) is negative control.

Target Names

TSPAN8

Uniprot No.

P19075

Alternative Names

Transmembrane 4 superfamily member 3; Tumor-associated antigen CO-029

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

1-237aa

Target Protein Sequence

MAGVSACIKYSMFTFNFLFWLCGILILALAIWVRVSNDSQAIFGSEDVGSSSYVAVDILIAVGAIIMILGFLGCCGAIKESRCMLLLFFIGLLLILLLQVATGILGAVFKSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKDFLAKNLIIVIGISFGLAVIEILGLVFSMVLYCQIGNK

Mol. Weight

27.4 kDa

Protein Length

Full Length

Tag Info

C-terminal 10xHis-tagged(This tag can be tested only under denaturing conditions)

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

The VLPs are expressed from human 293 cells (HEK293).Mix the sample gently by repeatedly pipetting it up and down. Do not vortex.Repeated freezing and thawing is not recommended.Store the protein at -20°C/-80°C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity. The immunization strategy should be optimized (antigen dose, regimen and adjuvant).

Datasheet & COA

Please contact us to get it.

Description

Tetraspanin-8 orchestrates tumor cell motility and exosome-mediated metastasis through its interactions with integrins and other membrane partners, making it a critical target in cancer progression research. This full-length construct (aa 1–237) presented on virus-like particles demonstrates specific antibody recognition with an EC50 of 2.26–2.62 ng/mL in functional ELISA, confirming that the native tetrameric architecture and extracellular loops retain their conformational epitopes. The quantified binding activity supports use in antibody development and validation workflows, where researchers require a physiologically relevant antigen presentation that mimics TSPAN8 display on tumor cell membranes and extracellular vesicles. With endotoxin levels below 1.0 EU/μg, this VLP format provides a suitable basis for cell-based assays investigating tumor metastasis mechanisms, including migration and invasion studies where TSPAN8-integrin complexes drive invasive phenotypes.

Target Background

Gene References into Functions

TSPAN8 mediated Wnt/beta-catenin pathway through binding to NOTCH2. The role of TSPAN8 in the drug resistance of gastric cancer. PMID: 29345284
these data point to a crucial role of Co-029 in the modulation of colon cancer cell motility which could be related to the protumoral effect reported for this tetraspanin. Among surface molecules able to mediate Co-029 function, E-cadherin, EGFR and CD44 appear as likely candidates. PMID: 28418857
Single nucleotide polymorphism in TSPAN8 gene is associated with pathogenesis of bipolar disorder. PMID: 28777493
Tetraspanin-8 has a role in promoting hepatocellular carcinoma metastasis by increasing ADAM12m expression PMID: 27270327
LCMR1 modulation was sufficient to positively regulate endogenous Tspan8 expression, with concomitant in vitro phenotypic changes such as loss of melanoma cell-matrix adherence and increase in invasion, and Tspan8 expression promoted tumourigenicity in vivo. PMID: 27375018
Data indicate a regulatory role for tetraspanin 8 (Tspan8) in melanoma progression by modulating cell-matrix interactions through beta1 integrin - integrin-linked kinase (ILK) axis and establish Tspan8 as a negative regulator of ILK activity. PMID: 28188308
TSPAN8 might be important for the orchestration of meprin beta at the cell surface with impact on certain proteolytic processes PMID: 27180358
Knocking down TSPAN8 in AEG-1-overexpressing human hepatocellular carcinoma (HCC) cells markedly inhibited invasion and migration without affecting proliferation. TSPAN8 knockdown profoundly abrogated AEG-1-induced primary tumor and intrahepatic metastasis in an orthopic xenograft model in athymic nude mice PMID: 27339400
Knockdown and knockout models revealed that CD151 and Tspan8 act as molecular facilitators in wound healing, angiogenesis and tumor progression. [review] PMID: 28408484
Results provide evidence that TSPAN8 may contribute to the pathogenesis of lung cancer by promoting cell viability and proliferation. PMID: 27996312
TSPAN8 is involved in tumor progression and is an independent prognostic classifier in patients with gastric cancer. PMID: 25711980
This novel nuclear localization of TM4SF3 depends on androgen-induced nuclear localization of androgen receptor (AR) in both androgen-dependent and androgen-independent prostate cancer cell lines PMID: 26649804
Our data suggest that TSPAN8-LEL may play an important role in mCRC cell invasion, and that the antibody we have developed could be a useful tool for inhibiting the invasion of TSPAN8-expressing mCRCs. PMID: 26562525
Based on nasopharyngeal TSPAN8 gene expression in readily available Nasopharyngeal aspirate samples , we can discriminate between severity of disease in Respiratory syncytial virus infected infants. PMID: 25261323
Tspn8 was over-expressed in multiple clinical malignant glioma tissues, and its expression level correlated with the grade of tumors. PMID: 25680464
CO-029 functions as a regulator of both cell-matrix and cell-cell adhesion. During colon cancer progression, CO-029 promotes cancer cell movement by deregulating cell adhesions. PMID: 22679508
PMA-induced Tspan8-internalization promotes cell migration, but reduces matrix and cell adhesion. PMID: 20937409
High TSPAN8 is associated with melanoma invasiveness. PMID: 21081927
claudin-7-associated EpCAM is recruited into (tetraspanin-enriched membrane microdomains) and forms a complex with CO-029 and CD44v6 that facilitates metastasis formation PMID: 17579117
overexpression of TM4SF3 in esophageal cancer conferred advantage to the invasion and metastasis of this destructive disease PMID: 18365756

Hide All

Subcellular Location

Membrane; Multi-pass membrane protein.

Protein Families

Tetraspanin (TM4SF) family

Tissue Specificity

Gastric, colon, rectal, and pancreatic carcinomas.

Database Links

HGNC: 11855

OMIM: 600769

KEGG: hsa:7103

STRING: 9606.ENSP00000247829

UniGene: Hs.170563

Code	CSB-MP025166HU
Abbreviation	Recombinant Human TSPAN8 protein-VLPs (Active)
MSDS	MSDS Datasheet
Size	$620
	Order now
Image	CSB-MP025166HU is detected by Mouse anti-6*His monoclonal antibody.(This tag can be tested only under denaturing conditions.) Activity Measured by its binding ability in a functional ELISA. Immobilized Human TSPAN8 at 5 μg/ml can bind Anti-TSPAN8 recombinant antibody (CSB-RA025166MA1HU). The EC₅₀ is 2.261-2.623 ng/mL.The VLPs (CSB-MP3838) is negative control. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Tetraspanin-8 (TSPAN8)-VLPs (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage