Recombinant Human Tetraspanin-8 (TSPAN8)

Code CSB-CF025166HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
TSPAN8; TM4SF3; Tetraspanin-8; Tspan-8; Transmembrane 4 superfamily member 3; Tumor-associated antigen CO-029
Species
Homo sapiens (Human)
Expression Region
1-237
Target Protein Sequence
MAGVSACIKYSMFTFNFLFWLCGILILALAIWVRVSNDSQAIFGSEDVGSSSYVAVDILI AVGAIIMILGFLGCCGAIKESRCMLLLFFIGLLLILLLQVATGILGAVFKSKSDRIVNET LYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRP CQSYNGKQVYKETCISFIKDFLAKNLIIVIGISFGLAVIEILGLVFSMVLYCQIGNK
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Gene References into Functions
  1. TSPAN8 mediated Wnt/beta-catenin pathway through binding to NOTCH2. The role of TSPAN8 in the drug resistance of gastric cancer. PMID: 29345284
  2. these data point to a crucial role of Co-029 in the modulation of colon cancer cell motility which could be related to the protumoral effect reported for this tetraspanin. Among surface molecules able to mediate Co-029 function, E-cadherin, EGFR and CD44 appear as likely candidates. PMID: 28418857
  3. Single nucleotide polymorphism in TSPAN8 gene is associated with pathogenesis of bipolar disorder. PMID: 28777493
  4. Tetraspanin-8 has a role in promoting hepatocellular carcinoma metastasis by increasing ADAM12m expression PMID: 27270327
  5. LCMR1 modulation was sufficient to positively regulate endogenous Tspan8 expression, with concomitant in vitro phenotypic changes such as loss of melanoma cell-matrix adherence and increase in invasion, and Tspan8 expression promoted tumourigenicity in vivo. PMID: 27375018
  6. Data indicate a regulatory role for tetraspanin 8 (Tspan8) in melanoma progression by modulating cell-matrix interactions through beta1 integrin - integrin-linked kinase (ILK) axis and establish Tspan8 as a negative regulator of ILK activity. PMID: 28188308
  7. TSPAN8 might be important for the orchestration of meprin beta at the cell surface with impact on certain proteolytic processes PMID: 27180358
  8. Knocking down TSPAN8 in AEG-1-overexpressing human hepatocellular carcinoma (HCC) cells markedly inhibited invasion and migration without affecting proliferation. TSPAN8 knockdown profoundly abrogated AEG-1-induced primary tumor and intrahepatic metastasis in an orthopic xenograft model in athymic nude mice PMID: 27339400
  9. Knockdown and knockout models revealed that CD151 and Tspan8 act as molecular facilitators in wound healing, angiogenesis and tumor progression. [review] PMID: 28408484
  10. Results provide evidence that TSPAN8 may contribute to the pathogenesis of lung cancer by promoting cell viability and proliferation. PMID: 27996312
  11. TSPAN8 is involved in tumor progression and is an independent prognostic classifier in patients with gastric cancer. PMID: 25711980
  12. This novel nuclear localization of TM4SF3 depends on androgen-induced nuclear localization of androgen receptor (AR) in both androgen-dependent and androgen-independent prostate cancer cell lines PMID: 26649804
  13. Our data suggest that TSPAN8-LEL may play an important role in mCRC cell invasion, and that the antibody we have developed could be a useful tool for inhibiting the invasion of TSPAN8-expressing mCRCs. PMID: 26562525
  14. Based on nasopharyngeal TSPAN8 gene expression in readily available Nasopharyngeal aspirate samples , we can discriminate between severity of disease in Respiratory syncytial virus infected infants. PMID: 25261323
  15. Tspn8 was over-expressed in multiple clinical malignant glioma tissues, and its expression level correlated with the grade of tumors. PMID: 25680464
  16. CO-029 functions as a regulator of both cell-matrix and cell-cell adhesion. During colon cancer progression, CO-029 promotes cancer cell movement by deregulating cell adhesions. PMID: 22679508
  17. PMA-induced Tspan8-internalization promotes cell migration, but reduces matrix and cell adhesion. PMID: 20937409
  18. High TSPAN8 is associated with melanoma invasiveness. PMID: 21081927
  19. claudin-7-associated EpCAM is recruited into (tetraspanin-enriched membrane microdomains) and forms a complex with CO-029 and CD44v6 that facilitates metastasis formation PMID: 17579117
  20. overexpression of TM4SF3 in esophageal cancer conferred advantage to the invasion and metastasis of this destructive disease PMID: 18365756

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
Tetraspanin (TM4SF) family
Tissue Specificity
Gastric, colon, rectal, and pancreatic carcinomas.
Database Links

HGNC: 11855

OMIM: 600769

KEGG: hsa:7103

STRING: 9606.ENSP00000247829

UniGene: Hs.170563

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1