Recombinant Macaca fascicularis C-type lectin domain family 4 member C(CLEC4C), partial (Active)

In Stock Promotion
Code CSB-MP4819MOV
Abbreviation Recombinant Cynomolgus monkey CLEC4C protein, partial (Active)
MSDS
Size $138
Order now
Promotion
20% OFF Promotion on CUSABIO Premium Active Proteins
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus CLEC4C at 2μg/mL can bind Anti-CLEC4C recombinant antibody(CSB-RA855470MA1HU),the EC50 is 5.506-6.472 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus CLEC4C at 2 μg/mL can bind Anti-CLEC4C recombinant antibody(CSB-RA855470MA1HU). The EC50 is 5.506-6.472 ng/mL.
Target Names
Uniprot No.
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Source
Mammalian cell
Expression Region
48-212aa
Target Protein Sequence
YSKTVKRLSKLQEYQQYYPSLTCVMEGKDMEDWSCCPTPWTSFQSSCYFISTVMQSWTKSQNNCSVMGADLVVINTKEEQDFITQNLKINSAYFLGLSDPKGWRHWQWVDQTPYNKNVTFWHSGEPNSPDERCAIINFRSEEWGWNDVHCHVPQKSICKMKKIYI
Mol. Weight
23.6 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-Myc-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This biologically active recombinant Macaca fascicularis CLEC4C is expressed in mammalian cells, encompassing residues 48-212 of CLEC4C, with an N-terminal 6×His-Myc tag. The recombinant CLEC4C protein exhibits high purity (>95% by SDS-PAGE) and low endotoxin levels (<1.0 EU/μg, LAL method), ensuring suitability for immunological studies. Functional analysis via ELISA confirms specific binding to anti-CLEC4C antibody(CSB-RA855470MA1HU) with an EC50 of 5.506–6.472 ng/mL when immobilized at 2 μg/mL, validating its structural integrity and antigenic properties. Mammalian expression ensures proper glycosylation and folding, which are critical for CLEC4C’s role in pathogen recognition and dendritic cell signaling. Presented as lyophilized powder, this preparation combines stability with ease of reconstitution. The dual 6×His-Myc tag facilitates purification and detection while preserving functional epitopes. This recombinant CLEC4C protein serves as a key tool for studying lectin-mediated immune responses, viral entry mechanisms, and therapeutic antibody development targeting CLEC4C-associated pathways in infectious diseases and immunology research.

The CLEC4C protein, which is a C-type lectin, plays a significant role in the immune response of cynomolgus macaques (Macaca fascicularis), a species commonly used as a non-human primate model in biomedical research. CLEC4C is involved in the recognition of specific carbohydrates on pathogens, contributing to the immune response against infections, although specific citations reflecting this function in cynomolgus macaques were not retrievable [1][2].

Cynomolgus macaques have been instrumental in understanding immune mechanisms through the study of proteins such as CLEC4C, particularly in contexts related to viral challenges such as SARS-CoV-2. Research has shown that different immune gene expressions can significantly vary between macaque species, which is crucial for evaluating vaccine efficacy and immune responses during experimental infections [2] and supports the idea that these animals are relevant for understanding the immune response dynamics [3]. Furthermore, their anatomical and physiological similarities to humans enhance their translational relevance in immunological studies [4].

Studies utilizing cynomolgus macaques have indicated that immunological pathways involving C-type lectins, like CLEC4C, are significant for recognizing pathogens and shaping adaptive immune responses in a model that closely resembles human conditions. These proteins' expression levels and functional properties may provide insights into the susceptibility of these animals to various infectious diseases, including those caused by zoonotic pathogens [4]. Therefore, understanding CLEC4C in Macaca fascicularis is vital for leveraging this species in vaccine development and infectious disease research.

References:
[1] A. Higashino, R. Sakate, et al. Whole-genome sequencing and analysis of the malaysian cynomolgus macaque (macaca fascicularis) genome. Genome Biology, vol. 13, no. 7, 2012. https://doi.org/10.1186/gb-2012-13-7-r58
[2] F. Salguero, A. White, et al. Comparison of rhesus and cynomolgus macaques as an infection model for covid-19. Nature Communications, vol. 12, no. 1, 2021. https://doi.org/10.1038/s41467-021-21389-9
[3] E. Hobbs and T. REID. Animals and sars‐cov‐2: species susceptibility and viral transmission in experimental and natural conditions, and the potential implications for community transmission. Transboundary and Emerging Diseases, vol. 68, no. 4, p. 1850-1867, 2020. https://doi.org/10.1111/tbed.13885
[4] G. Doxiadis, A. Vos-Rouweler, N. Groot, Ń. Otting, & R. Bontrop. Dr haplotype diversity of the cynomolgus macaque as defined by its transcriptome. Immunogenetics, vol. 64, no. 1, p. 31-37, 2011. https://doi.org/10.1007/s00251-011-0561-5

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*