Recombinant Macaca fascicularis C-type lectin domain family 4 member C(CLEC4C), partial (Active)

In Stock
Code CSB-MP4819MOV
Abbreviation Recombinant Cynomolgus monkey CLEC4C protein, partial (Active)
MSDS
Size $138
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus CLEC4C at 2μg/mL can bind Anti-CLEC4C recombinant antibody(CSB-RA855470MA1HU),the EC50 is 5.506-6.472 ng/mL. Biological Activity Assay
  • CLEC4C Recombinant Monoclonal Antibody (CSB-RA855470MA1HU) captured on Protein A Chip can bind Recombinant Human CLEC4C protein with an affinity constant of 84.8 pM as detected by MetaSPR Assay (WeSPRTM 200).
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus CLEC4C at 2 μg/mL can bind Anti-CLEC4C recombinant antibody(CSB-RA855470MA1HU). The EC50 is 5.506-6.472 ng/mL.
Target Names
Uniprot No.
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Source
Mammalian cell
Expression Region
48-212aa
Target Protein Sequence
YSKTVKRLSKLQEYQQYYPSLTCVMEGKDMEDWSCCPTPWTSFQSSCYFISTVMQSWTKSQNNCSVMGADLVVINTKEEQDFITQNLKINSAYFLGLSDPKGWRHWQWVDQTPYNKNVTFWHSGEPNSPDERCAIINFRSEEWGWNDVHCHVPQKSICKMKKIYI
Mol. Weight
23.6 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-Myc-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

CLEC4C, a C-type lectin receptor expressed on plasmacytoid dendritic cells, mediates endocytic uptake and immune signaling, making it a target of interest in antiviral immunity and autoimmune disease models. This cynomolgus macaque ortholog, spanning residues 48–212 and encompassing the extracellular carbohydrate-recognition domain, demonstrates quantifiable antibody-binding activity with an EC50 of 5.506–6.472 ng/mL in functional ELISA, providing a validated reagent for therapeutic antibody epitope mapping and competitive inhibition screening in translational primate studies. Mammalian cell expression preserves the native glycosylation and disulfide architecture critical for lectin domain folding, supporting its use in ligand-binding assays, surface plasmon resonance affinity characterization, and biolayer interferometry experiments that demand conformationally intact receptor. Purity exceeding 95% by SDS-PAGE and endotoxin below 1.0 EU/μg align with standards expected in antibody screening workflows and receptor-ligand interaction studies where low background and minimal inflammatory artifacts are essential.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*