Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus CLEC4C at 2 μg/mL can bind Anti-CLEC4C recombinant antibody(CSB-RA855470MA1HU). The EC50 is 5.506-6.472 ng/mL.

Target Names

CLEC4C

Uniprot No.

A0A2K5UWP4

Species

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Source

Mammalian cell

Expression Region

48-212aa

Target Protein Sequence

YSKTVKRLSKLQEYQQYYPSLTCVMEGKDMEDWSCCPTPWTSFQSSCYFISTVMQSWTKSQNNCSVMGADLVVINTKEEQDFITQNLKINSAYFLGLSDPKGWRHWQWVDQTPYNKNVTFWHSGEPNSPDERCAIINFRSEEWGWNDVHCHVPQKSICKMKKIYI

Mol. Weight

23.6 kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-Myc-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

CLEC4C, a C-type lectin receptor expressed on plasmacytoid dendritic cells, mediates endocytic uptake and immune signaling, making it a target of interest in antiviral immunity and autoimmune disease models. This cynomolgus macaque ortholog, spanning residues 48–212 and encompassing the extracellular carbohydrate-recognition domain, demonstrates quantifiable antibody-binding activity with an EC50 of 5.506–6.472 ng/mL in functional ELISA, providing a validated reagent for therapeutic antibody epitope mapping and competitive inhibition screening in translational primate studies. Mammalian cell expression preserves the native glycosylation and disulfide architecture critical for lectin domain folding, supporting its use in ligand-binding assays, surface plasmon resonance affinity characterization, and biolayer interferometry experiments that demand conformationally intact receptor. Purity exceeding 95% by SDS-PAGE and endotoxin below 1.0 EU/μg align with standards expected in antibody screening workflows and receptor-ligand interaction studies where low background and minimal inflammatory artifacts are essential.

Code	CSB-MP4819MOV
Abbreviation	Recombinant Cynomolgus monkey CLEC4C protein, partial (Active)
MSDS	MSDS Datasheet
Size	$9.9
Promotion
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus CLEC4C at 2μg/mL can bind Anti-CLEC4C recombinant antibody(CSB-RA855470MA1HU)，the EC₅₀ is 5.506-6.472 ng/mL. Biological Activity Assay CLEC4C Recombinant Monoclonal Antibody (CSB-RA855470MA1HU) captured on Protein A Chip can bind Recombinant Human CLEC4C protein with an affinity constant of 84.8 pM as detected by MetaSPR Assay (WeSPRTM 200).
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Macaca fascicularis C-type lectin domain family 4 member C(CLEC4C), partial (Active)

Product Details

Customer Reviews and Q&A

×CloseMessage