Recombinant Macaca fascicularis CD93 molecule (CD93), partial (Active)

In Stock
Code CSB-MP4279MOV
Abbreviation Recombinant Cynomolgus monkey CD93 protein, partial (Active)
MSDS
Size $114
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis CD93 at 2 μg/ml can bind Anti-CD93 recombinant antibody (CSB-RA865099MA1HU), the EC50 is 0.1669-0.3513 ng/mL.
  • The purity of CD93 was greater than 95% as determined by SEC-HPLC
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
≥ 95% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis CD93 at 2 μg/mL can bind Anti-CD93 recombinant antibody (CSB-RA865099MA1HU), the EC50 is 0.1669-0.3513 ng/mL.
Target Names
Uniprot No.
Molecular Characterization
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Source
Mammalian cell
Expression Region
24-581aa
Target Protein Sequence
ADTEAVVCAGTACYTAHWGKLSAAEAQNLCLQNGGNLATVKSEEEAQHVQQVLAQLLRREAALTARMGKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPGRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDDSQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTCASRNPCSSSPCRGGATCIPGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVNTPGSFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTEGSFHCSCEEGYVLAGEDGTQCQDVDECVGPGGPLCDSLCFNTQGSFRCGCLPGWVLAPNGVSCAMGPVSLGPPSGPPDEEYKGEREGSTVPPAATASPTRGPEGTPKSTPTTRRPLLSSDAPITSVPLEVLAPSGSPGLWREPSIHHTTAASGAQEPAGGDSSVATQNDDGTDGQKL
Mol. Weight
60.2 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

CD93 plays a key role in cell adhesion, phagocytosis, and angiogenesis, making its extracellular domain a valuable target for antibody development and receptor-ligand interaction studies. This cynomolgus monkey CD93 construct covers residues 24–581, encompassing the extracellular region critical for ligand engagement, and is expressed in mammalian cells to support native-like glycosylation and proper folding of its C-type lectin and EGF-like domains. Functional ELISA confirms robust binding activity, with immobilized CD93 at 2 μg/ml engaging an anti-CD93 recombinant antibody at an EC₅₀ of 0.1669–0.3513 ng/mL, providing a suitable basis for competitive blocking antibody screening, epitope mapping, and affinity characterization by SPR or BLI. The protein carries a C-terminal 10×His tag for oriented capture, and with purity exceeding 95% by SDS-PAGE alongside endotoxin levels below 1.0 EU/μg, it meets the quality thresholds commonly required for cell-based binding assays and biologic inhibitor screening campaigns.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*