Recombinant Macaca fascicularis G protein-coupled receptor 20 (GPR20)-VLPs (Active)

In Stock Promotion
Code CSB-MP5431MOV
Abbreviation Recombinant Cynomolgus monkey GPR20 protein-VLPs (Active)
MSDS
Size $630
Order now
Promotion
20% OFF Promotion on CUSABIO Premium Active Proteins
Image
  • CSB-MP5431MOV is detected by Mouse anti-6*His monoclonal antibody.(This tag can be tested only under denaturing conditions.)
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis GPR20 at 10 μg/ml can bind Anti-GPR20 recombinant antibody(CSB-RA860774MA1HU). The EC50 is 3.549 - 6.542 ng/mL.The VLPs (CSB-MP3838) is negative control. Biological Activity Assay
  • The purity of VLPs was greater than 95% as determined by SEC-HPLC
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SEC-HPLC.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis GPR20 at 10 μg/mL can bind Anti-GPR20 recombinant antibody(CSB-RA860774MA1HU). The EC50 is 3.549 - 6.542 ng/mL.The VLPs (CSB-MP3838) is negative control.
Target Names
Uniprot No.
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Source
Mammalian cell
Expression Region
1-359aa
Target Protein Sequence
MPSVSPVGPSAGAVPNATAVTTVWTNASGLEVPLFHLFARLDEELHGTFPGLWLALMAVHGAIFLVGLVLNGLALYVFCCRTQAKTPSVIYTINLVVTDLLVGLSLPTRFAVYYGARGCLHCAFPHVLGYFLNMHCSILFLTCICVDRYLAIVRPEGSRRCRQPACARAVCAFVWLAAGAVTLSVLGMTGGRPCCRVFALTVLEFLLPLLVISVFTGRIMCALSRPGLLRQGRQRRVRAMQLLLTVLIIFLVCFTPFHARQVAVALWPDMPHHASLVVYHVAVTLSSLNSCMDPIVYCFVTSGFQATVRGLFGQHRGEREPSSGDVVSMHRSSKGSGRHHILSAGPHALTQALANGPEA
Mol. Weight
40.2 kDa
Protein Length
Full Length
Tag Info
C-terminal 10xHis-tagged(This tag can be tested only under denaturing conditions)
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
The VLPs are expressed from human 293 cells (HEK293).Mix the sample gently by repeatedly pipetting it up and down. Do not vortex.Repeated freezing and thawing is not recommended.Store the protein at -20°C/-80°C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity. The immunization strategy should be optimized (antigen dose, regimen and adjuvant).
Datasheet & COA
Please contact us to get it.
Description

The recombinant Macaca fascicularis GPR20 protein is produced as a virus-like particle (VLP), enabling it to maintain a membrane-associated conformation that closely mimics its native state. Expressed in mammalian cells, this construct includes the full-length GPR20 sequence (amino acids 1–359) and features a C-terminal 10xHis tag for purification and analytical use. The recombinant GPR20 protein is supplied in lyophilized form and demonstrates high purity, exceeding 95% as determined by SEC-HPLC. Functional validation in an ELISA assay confirms its ability to bind the anti-GPR20 recombinant antibody (CSB-RA860774MA1HU) when immobilized at 10 μg/mL, with an EC50 ranging from 3.549 to 6.542 ng/mL. The specificity of the assay is supported by a negative VLP control (CSB-MP3838). With its preserved structural integrity and confirmed activity, this GPR20 VLP is a reliable reagent for studies involving G protein-coupled receptor function, antibody screening, or therapeutic development.

The GPR20 protein in Macaca fascicularis, commonly known as the cynomolgus macaque, is part of a broader category of GPCRs. These receptors play essential roles in various physiological processes by mediating signal transduction, particularly in response to extracellular stimuli. While specific studies directly focusing on GPR20 in Macaca fascicularis are limited, we can draw from the general characteristics of GPCRs and their relevance in the context of primate biology and health, particularly concerning metabolic processes and disease models.

GPCRs typically operate through G proteins to facilitate intracellular signaling pathways pivotal for regulating multiple physiological functions such as hormone responses, sensory perception, and immune responses. In primates, including Macaca fascicularis, the variety of GPCRs, including orphan receptors such as GPR20, raises significant interest in their potential roles in disease mechanisms and drug responses, especially as cynomolgus macaques serve as vital models for biomedical research [1][2].

Recent research indicates that GPCRs, and potentially GPR20, are associated with metabolic alterations as observed in studies involving macaque models for diabetes and metabolic syndrome. These conditions are critical areas of study given their parallels to human physiology and disease [3]. Moreover, the variations in GPCR signaling pathways among different primate species can provide insights into evolutionary adaptations and functional discrepancies that influence drug metabolism and therapeutic responses in humans [4].

Alongside these metabolic implications, various studies emphasize the importance of the cynomolgus macaque as a representative model for assessing neurological disorders. Research surrounding GPCR interactions—including that possibly involving GPR20—may elucidate new pathways for understanding complex interactions in neurodegenerative diseases, which affect both human and primate health. For instance, the involvement of GPCRs in dopamine signaling pathways has been studied extensively within MPTP-induced parkinsonian macaque models, demonstrating the intricate relationships between receptor signaling, brain function, and behavioral outcomes [5].

References:
[1] J. Estes, S. Wong, & J. Brenchley. Nonhuman primate models of human viral infections. Nature Reviews Immunology, vol. 18, no. 6, p. 390-404, 2018. https://doi.org/10.1038/s41577-018-0005-7
[2] S. Kanthaswamy, J. Ng, et al. The genetic composition of populations of cynomolgus macaques (macaca fascicularis) used in biomedical research. Journal of Medical Primatology, vol. 42, no. 3, p. 120-131, 2013. https://doi.org/10.1111/jmp.12043
[3] S. Laila, D. Astuti, I. Suparto, E. Handharyani, T. Register, & D. Sajuthi. Atherosclerotic lesion of the carotid artery in indonesian cynomolgus monkeys receiving a locally sourced atherogenic diet. Veterinary Sciences, vol. 9, no. 3, p. 105, 2022. https://doi.org/10.3390/vetsci9030105
[4] S. Pérez, M. Vernica, & O. Rascol. Ayurveda medicine for the treatment of parkinson’s disease. International Journal of Integrative Medicine, p. 1, 2013. https://doi.org/10.5772/56251
[5] L. Tian, Y. Xia, H. Flores, M. Campbell, S. Moerlein, & J. Perlmutter. Neuroimaging analysis of the dopamine basis for apathetic behaviors in an mptp-lesioned primate model. Plos One, vol. 10, no. 7, p. e0132064, 2015. https://doi.org/10.1371/journal.pone.0132064

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*