Home
Active Protein
Other
Recombinant Macaca fascicularis G protein-coupled receptor 20 (GPR20)-VLPs (Active)

Recombinant Macaca fascicularis G protein-coupled receptor 20 (GPR20)-VLPs (Active)

^{In Stock}

Code	CSB-MP5431MOV
Abbreviation	Recombinant Cynomolgus monkey GPR20 protein-VLPs (Active)
MSDS	MSDS Datasheet
Size	$620
	Order now
Image	CSB-MP5431MOV is detected by Mouse anti-6*His monoclonal antibody.(This tag can be tested only under denaturing conditions.) Activity Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis GPR20 at 10 μg/ml can bind Anti-GPR20 recombinant antibody(CSB-RA860774MA1HU). The EC₅₀ is 3.549 - 6.542 ng/mL.The VLPs (CSB-MP3838) is negative control. Biological Activity Assay The purity of VLPs was greater than 95% as determined by SEC-HPLC
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Customer Reviews and Q&A

Product Details

Purity

≥ 95% as determined by SEC-HPLC.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis GPR20 at 10 μg/mL can bind Anti-GPR20 recombinant antibody(CSB-RA860774MA1HU). The EC50 is 3.549 - 6.542 ng/mL.The VLPs (CSB-MP3838) is negative control.

Target Names

GPR20

Uniprot No.

XP_015310747.1

Species

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Source

Mammalian cell

Expression Region

1-359aa

Target Protein Sequence

MPSVSPVGPSAGAVPNATAVTTVWTNASGLEVPLFHLFARLDEELHGTFPGLWLALMAVHGAIFLVGLVLNGLALYVFCCRTQAKTPSVIYTINLVVTDLLVGLSLPTRFAVYYGARGCLHCAFPHVLGYFLNMHCSILFLTCICVDRYLAIVRPEGSRRCRQPACARAVCAFVWLAAGAVTLSVLGMTGGRPCCRVFALTVLEFLLPLLVISVFTGRIMCALSRPGLLRQGRQRRVRAMQLLLTVLIIFLVCFTPFHARQVAVALWPDMPHHASLVVYHVAVTLSSLNSCMDPIVYCFVTSGFQATVRGLFGQHRGEREPSSGDVVSMHRSSKGSGRHHILSAGPHALTQALANGPEA

Mol. Weight

40.2 kDa

Protein Length

Full Length

Tag Info

C-terminal 10xHis-tagged(This tag can be tested only under denaturing conditions)

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

The VLPs are expressed from human 293 cells (HEK293).Mix the sample gently by repeatedly pipetting it up and down. Do not vortex.Repeated freezing and thawing is not recommended.Store the protein at -20°C/-80°C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity. The immunization strategy should be optimized (antigen dose, regimen and adjuvant).

Datasheet & COA

Please contact us to get it.

Description

GPR20 remains an orphan G-protein coupled receptor with poorly defined ligand specificity, making validated reagents essential for deorphanization efforts and functional characterization. This full-length cynomolgus macaque GPR20 (aa 1–359) is presented on virus-like particles to preserve native membrane topology and conformational epitopes, enabling antibody binding with an EC50 of 3.549–6.542 ng/mL against a recombinant anti-GPR20 antibody in functional ELISA. The demonstrated antibody recognition supports use in therapeutic antibody epitope mapping, competitive inhibition screening to identify blocking candidates, and ligand-binding assays designed to identify endogenous or synthetic agonists. With endotoxin levels below 1.0 EU/μg, this VLP-displayed receptor meets the quality thresholds commonly required for surface plasmon resonance affinity characterization and biolayer interferometry studies where low background interference is critical for accurate kinetic measurements.