Code | CSB-PA026960LA01HU |
Size | US$166 |
Order now | |
Image |
|
The Latest Promotion | |
Have Questions? | Leave a Message or Start an on-line Chat |
The ZNF699 Antibody (Product code: CSB-PA026960LA01HU) is Non-conjugated. For ZNF699 Antibody with conjugates, please check the following table.
Application | Recommended Dilution |
---|---|
WB | 1:500-1:2000 |
IHC | 1:20-1:200 |
There are currently no reviews for this product.
Hi, I am interested if this ZNF699 Antibody is a C-terminal one?
The ZNF699 Antibody (CSB-PA026960LA01HU) was raised against N-terminal sequence of human ZNF699. I provided below the exact immunogen sequence, hope this will be helpful.
Immunogen: Recombinant Human Zinc finger protein 699 protein (19-195aa)
Sequence: VVFEDVAVDFTQEEWALLDLAQRNLYRDVMLENFQNLASLGYPLHTPHLISQWEQEEDLQTVKRELIQGIFMGEHREGFETQLKTNESVASQDICGEKISNEQKIVRFKRNDSWFSSLHENQESCGIDYQNKSHERHLRNHMVENIYECYEENQDGQTFSQVPNLDSLKRNTEVKSC