Recombinant Staphylococcus aureus Autolysin (lytA)

Code CSB-EP326479FKZ
Abbreviation Recombinant Staphylococcus aureus lytA protein
MSDS
Size US$256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
lytA
Uniprot No.
Research Area
others
Alternative Names
lytAAutolysin; EC 3.5.1.28; N-acetylmuramoyl-L-alanine amidase
Species
Staphylococcus aureus
Source
E.coli
Expression Region
1-481aa
Target Protein Sequence
MQAKLTKNEFIERLKTSEGKQFNVDLWYGFQCFDYANAGWKVLFGLLLKGLGAKDIPFANNFDGLATVYQNTPDFLAQPGDMVVFGSNYGAGYGHVAWVIEATLDYIIVYEQNWLGGGWTDGIEQPAGVGKKLQDDNMLMISLCGLSVRILKVRQRHDQFNLLHKHPKKETAKPQPKAVELKIIKDVVKGYDLPKRGSNPKGIVIHNDAGSKGATAEAYRNGLVNAPLSRLEAGIAHSYVSGNTVWQALDESQVGWHTANQIGNKYYYGIEVCQSMGADNATFLKNEQATFQECARLLKKWGLPANRNTIRLHNEFTSTSCPHRSSVLHTGFDPVTRGLLPEDKRLQLKDYFIKQIRAYMDGKIPVATVSNESSASSNTVKPVASAWKRNKYGTYYMEESARFTNGNQPITVRKVGPFLSCPVGYQFQPGGYCDYTEVMLQDGHVWVGYTWEGQRYYLPIRTWNGSAPPNQILGDLWGEIS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
57.8 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This recombinant Staphylococcus aureus Autolysin (lytA) is produced in an E.coli expression system and contains the complete protein region spanning amino acids 1 to 481. The protein carries an N-terminal 6xHis-tag, which makes purification and detection more straightforward. SDS-PAGE analysis indicates a purity level greater than 90%, suggesting it should perform reliably in most research applications.

Staphylococcus aureus Autolysin plays an important role in breaking down bacterial cell walls, particularly during cell division and autolysis. Scientists studying autolysins like lytA hope to better understand how they function in bacterial physiology and disease development. There's also growing interest in how these proteins might contribute to antibiotic resistance and help bacteria survive hostile conditions. This knowledge could prove valuable when developing new treatments for bacterial infections.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant Staphylococcus aureus Autolysin is expressed in E. coli, a prokaryotic system that is generally suitable for expressing bacterial proteins. Since autolysin is a native bacterial enzyme, the E. coli expression environment has a reasonable probability of supporting its correct folding, as it likely shares similar requirements for disulfide bond formation and lacks complex eukaryotic post-translational modifications. The expression of the full-length protein (1-481aa) further increases the likelihood of proper folding. However, the protein's activity is unknown and unvalidated. The presence of an N-terminal 6xHis tag could potentially, though not necessarily, influence folding or function. Therefore, while the probability of correct folding is reasonably high, it cannot be guaranteed without experimental confirmation of enzymatic activity (e.g., lytic activity against S. aureus cell walls).

1. Protein-Protein Interaction Studies Using His-Tag Affinity Purification

The N-terminal 6xHis tag facilitates purification and immobilization for pull-down assays. However, this application is critically dependent on correct protein folding. If the autolysin is misfolded, its ability to interact with true biological partners from bacterial cell extracts will be compromised, leading to the identification of non-physiological interactions or false negatives. Folding and activity should be validated prior to such studies.

2. Antibody Development and Immunoassay Applications

This application is generally suitable. The recombinant autolysin can effectively serve as an immunogen for generating antibodies. Even if the protein is not in its perfect native conformation, it can elicit antibodies that recognize linear epitopes, which are useful for techniques like Western blotting. The high purity is adequate for immunization. However, it should be noted that antibodies generated against a potentially misfolded protein might not recognize the native, functionally active autolysin in its physiological context. The protein is an excellent positive control for Western blots, as this technique uses denatured proteins.

3. Biochemical Characterization and Substrate Binding Studies

This application is not only appropriate but should be considered a prerequisite for functional studies. The described experiments (pH optimum, thermal stability, binding to peptidoglycan) are the very methods used to determine the protein's folded state and bioactivity. The His-tag is beneficial for immobilization in binding assays like SPR. If the protein shows the expected enzymatic or binding activity, it confirms correct folding. If inactive, these studies will characterize an inactive product.

4. Comparative Protein Structure and Function Analysis

This application is appropriate for structural analysis. Techniques like size exclusion chromatography and dynamic light scattering can directly assess the protein's oligomeric state and folding in solution. Comparative studies with other autolysins can be informative even if the protein is misfolded, as it would highlight differences in stability or behavior. Proteolysis mapping can identify stable domains. This application is valuable for characterizing the recombinant product itself, regardless of its native activity.

Final Recommendation & Action Plan

The recommended course of action is to prioritize biochemical characterization (Application #3) to definitively assess the protein's folding and bioactivity before proceeding to more complex functional studies. This should include enzymatic activity assays using S. aureus cell walls or synthetic substrates to confirm lytic function, and biophysical analysis (e.g., SEC, DLS) to check for proper oligomerization and solubility. If the protein is active and correctly folded, it can be reliably used for interaction studies (#1) and as a standard for native-conformation antibodies. If it is inactive, focus should shift to applications that are less conformation-dependent, such as linear-epitope antibody production (#2) and comparative structural analysis (#4). Validation against a native autolysin preparation is always advised for critical biological conclusions.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Autolysins are involved in some important biological processes such as cell separation, cell-wall turnover, competence for genetic transformation, formation of the flagella and sporulation. Autolysin strictly depends on the presence of choline-containing cell walls for activity.
Subcellular Location
Secreted.
Protein Families
N-acetylmuramoyl-L-alanine amidase 2 family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*