Recombinant MouseV-set domain containing T-cell activation inhibitor 1 (Vtcn1)

Code CSB-MP742524MO
Abbreviation Recombinant Mouse Vtcn1 protein
MSDS
Size $138
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Others
Alternative Names
B7 homolog 4;B7-H4;Immune costimulatory protein B7-H4;Protein B7S1;T cell costimulatory molecule B7x
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
25-257aa
Target Protein Sequence
LIIGFGISGKHFITVTTFTSAGNIGEDGTLSCTFEPDIKLNGIVIQWLKEGIKGLVHEFKEGKDDLSQQHEMFRGRTAVFADQVVVGNASLRLKNVQLTDAGTYTCYIRTSKGKGNANLEYKTGAFSMPEINVDYNASSESLRCEAPRWFPQPTVAWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTDSEVKRRSQLQLLNSG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
27.0 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Negatively regulates T-cell-mediated immune response by inhibiting T-cell activation, proliferation, cytokine production and development of cytotoxicity. When expressed on the cell surface of tumor macrophages, plays an important role, together with regulatory T-cells (Treg), in the suppression of tumor-associated antigen-specific T-cell immunity. Involved in promoting epithelial cell transformation.
Gene References into Functions
  1. this study shows that B7-H4 knockout hosts mount greater tumor-associated anti-tumor T cell responses and display reduced tumors PMID: 28074226
  2. Results highlight an importance of VTCN1 stabilization on cell surfaces for the restoration of altered balance of immune control during T1D. PMID: 26773144
  3. B7-H4 expression by nonhematopoietic cells in the tumor microenvironment promotes antitumor immunity. PMID: 25527357
  4. that B7x can modulate kidney damage in autoimmune diseases including lupus nephritis and anti-glomerular basement membrane disease PMID: 25205493
  5. B7-H4 can inhibit both antitumor T cells and protumor myeloid-derived suppressor cells ( PMID: 23686485
  6. The endogenous expression of B7-H4 in donor beta cells from transgenic mice prolongs islet allograft survival, confirming the negative role of B7-H4 in regulating alloreactive T-cell responses. PMID: 23192157
  7. Local overexpression of B7x on pancreatic beta cells is sufficient to abolish CD8 T cell-induced diabetes. PMID: 22972920
  8. An enhanced T cell response contributes to reduced lethality in a pulmonary infection model with Streptococcus pneumoniae. PMID: 22855708
  9. B7-H4 expression may influence the outcome of T-cell tumor cell interactions. Tumor-associated macrophage induced membrane-bound B7-H4 on lung cancer cell represents a novel mechanism by which lung cancer cells evade immune recognition and destruction. PMID: 22108530
  10. Overexpression of B7-H4 was shown in tumor infiltrated dendritic cells. PMID: 21728826
  11. Tissue-specific expression of B7x protects from CD4 T cell-mediated autoimmunity. PMID: 21727190
  12. intact recipient, but not donor, B7-H4 is essential for prolongation of allograft survival by blocking CD28/CTLA4:B7 pathway using CTLA4-Ig. PMID: 21143433
  13. studies reveal a novel role for activated hepatic stellate cells in the attenuation of intrahepatic T cell responses by way of expression of the coinhibitory molecule B7-H4. PMID: 21064155
  14. May participate in negative regulation of cell-mediated immunity in peripheral tissues PMID: 12818165
  15. novel negative costimulator and regulates the threshold of T cell activation PMID: 12818166
  16. Genomic DNA of mouse B7-H4 is mapped on chromosome 3 comprised of six exons and five introns spanning 66 kb. PMID: 14568939
  17. These results suggest that B7-H4 is one of multiple negative cosignaling molecules that collectively provide a fine-tuning mechanism for T-cell-mediated immune responses. PMID: 16914726
  18. T-cell and epithelial cell crosstalk-associated B7-H4 induces T-cell activation and is a potential activator that promotes tubular lesion PMID: 17051145
  19. B7-H4 is a negative regulator of the neutrophil response to infection PMID: 19109567
  20. Local expression of B7-H4 prolongs islet allograft survival in vivo, suggesting translational potential for beta-cell replacement with reduced immune injury. PMID: 19307783
  21. these results suggest a different action of B7-H4 in T cell-mediated inflammatory responses and the possible involvement of soluble B7-H4 in inflammatory immune responses. PMID: 19723502

Show More

Hide All

Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor.
Protein Families
Immunoglobulin superfamily, BTN/MOG family
Tissue Specificity
Expressed on the surface of professional antigen-presenting cells (at protein level). Widely expressed, including in kidney, liver, lung, pancreas, placenta, prostate, spleen, testis and thymus.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*