Purity
Greater than 85% as determined by SDS-PAGE.
Alternative Names
nifH; Nitrogenase iron protein; EC 1.18.6.1; Nitrogenase Fe protein; Nitrogenase component II; Nitrogenase reductase; Fragment
Species
Rhizobium leguminosarum
Target Protein Sequence
MAALRQIAFYGKGGIGKSTTSQNTLAALVDHHVPRIPMIIRIGGYAQ
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant R. leguminosarum nifH protein is encoded by the gene of nifH (1-47aa). The gene of nifH was cloned in a system (E.coli) that supported the expression of nifH and translation of messenger RNA. Modification of nifH by recombinant DNA technology could lead to the expression of the target protein. The protein was fused with N-terminal 10xHis-GST tag & C-terminal Myc tag in the production. The purity is 85% determined by SDS-PAGE.
nifH is a protein coding gene that encodes Nitrogenase iron protein. According to some research, nifH may have the following features.
Through molecular evolution analysis of nifH gene sequence, significant diversity of nitrogen-fixing bacteria was found in rice roots. Comprehensive evaluation of PCR primer amplification of nitrase nifH gene. Improve the RFLP program to study the diversity of nifH genes in the nitrogen-fixing agent communities in the soil. Analysis of the complexity of the nifH gene pool in soil and garbage in Douglas Fir Forest Farm in the Karst Mountains of Oregon. The comparison of nifH gene pools in soil and soil microenvironment is completely different in nature. Amplification of the nifH gene of the marine cyanobacterium Trichodesmium thiebautii using degenerate oligonucleotides.