Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

nifH

Uniprot No.

P20623

Research Area

Others

Alternative Names

nifH; Nitrogenase iron protein; EC 1.18.6.1; Nitrogenase Fe protein; Nitrogenase component II; Nitrogenase reductase; Fragment

Species

Rhizobium leguminosarum

Source

E.coli

Expression Region

1-47aa

Target Protein Sequence

MAALRQIAFYGKGGIGKSTTSQNTLAALVDHHVPRIPMIIRIGGYAQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

35.0 kDa

Protein Length

Full Length

Tag Info

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The recombinant R. leguminosarum nifH protein is encoded by the gene of nifH (1-47aa). The gene of nifH was cloned in a system (E.coli) that supported the expression of nifH and translation of messenger RNA. Modification of nifH by recombinant DNA technology could lead to the expression of the target protein. The protein was fused with N-terminal 10xHis-GST tag & C-terminal Myc tag in the production. The purity is 85% determined by SDS-PAGE.

nifH is a protein coding gene that encodes Nitrogenase iron protein. According to some research, nifH may have the following features.
Through molecular evolution analysis of nifH gene sequence, significant diversity of nitrogen-fixing bacteria was found in rice roots. Comprehensive evaluation of PCR primer amplification of nitrase nifH gene. Improve the RFLP program to study the diversity of nifH genes in the nitrogen-fixing agent communities in the soil. Analysis of the complexity of the nifH gene pool in soil and garbage in Douglas Fir Forest Farm in the Karst Mountains of Oregon. The comparison of nifH gene pools in soil and soil microenvironment is completely different in nature. Amplification of the nifH gene of the marine cyanobacterium Trichodesmium thiebautii using degenerate oligonucleotides.

Target Background

Function

The key enzymatic reactions in nitrogen fixation are catalyzed by the nitrogenase complex, which has 2 components: the iron protein and the molybdenum-iron protein.

Protein Families

NifH/BchL/ChlL family

Code	CSB-EP321828RKN
Abbreviation	Recombinant Rhizobium leguminosarum nifH protein, partial
MSDS	MSDS Datasheet
Size	$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Rhizobium leguminosarum Nitrogenase iron protein (nifH)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage