Recombinant Rhizobium leguminosarum Nitrogenase iron protein (nifH)

In Stock
Code CSB-EP321828RKN
Abbreviation Recombinant Rhizobium leguminosarum nifH protein, partial
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
nifH
Uniprot No.
Research Area
Others
Alternative Names
nifH; Nitrogenase iron protein; EC 1.18.6.1; Nitrogenase Fe protein; Nitrogenase component II; Nitrogenase reductase; Fragment
Species
Rhizobium leguminosarum
Source
E.coli
Expression Region
1-47aa
Target Protein Sequence
MAALRQIAFYGKGGIGKSTTSQNTLAALVDHHVPRIPMIIRIGGYAQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
35.0 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant R. leguminosarum nifH protein is encoded by the gene of nifH (1-47aa). The gene of nifH was cloned in a system (E.coli) that supported the expression of nifH and translation of messenger RNA. Modification of nifH by recombinant DNA technology could lead to the expression of the target protein. The protein was fused with N-terminal 10xHis-GST tag & C-terminal Myc tag in the production. The purity is 85% determined by SDS-PAGE.

nifH is a protein coding gene that encodes Nitrogenase iron protein. According to some research, nifH may have the following features.
Through molecular evolution analysis of nifH gene sequence, significant diversity of nitrogen-fixing bacteria was found in rice roots. Comprehensive evaluation of PCR primer amplification of nitrase nifH gene. Improve the RFLP program to study the diversity of nifH genes in the nitrogen-fixing agent communities in the soil. Analysis of the complexity of the nifH gene pool in soil and garbage in Douglas Fir Forest Farm in the Karst Mountains of Oregon. The comparison of nifH gene pools in soil and soil microenvironment is completely different in nature. Amplification of the nifH gene of the marine cyanobacterium Trichodesmium thiebautii using degenerate oligonucleotides.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
The key enzymatic reactions in nitrogen fixation are catalyzed by the nitrogenase complex, which has 2 components: the iron protein and the molybdenum-iron protein.
Protein Families
NifH/BchL/ChlL family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*