Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Target Names

IAA3

Uniprot No.

Q38822

Research Area

Others

Alternative Names

Indoleacetic acid-induced protein 3;Short hypocotyl;Suppressor of HY2

Species

Arabidopsis thaliana (Mouse-ear cress)

Source

E.coli

Expression Region

1-189aa

Target Protein Sequence

MDEFVNLKETELRLGLPGTDNVCEAKERVSCCNNNNKRVLSTDTEKEIESSSRKTETSPPRKAQIVGWPPVRSYRKNNIQSKKNESEHEGQGIYVKVSMDGAPYLRKIDLSCYKGYSELLKALEVMFKFSVGEYFERDGYKGSDFVPTYEDKDGDWMLIGDVPWEMFICTCKRLRIMKGSEAKGLGCGV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

28.4 kDa

Protein Length

Full Length

Tag Info

C-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Datasheet & COA

Please contact us to get it.

Target Background

Function

Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations. Repression is thought to result from the interaction with auxin response factors (ARFs), proteins that bind to the auxin-responsive promoter element (AuxRE). Plays a central role in auxin regulation of root growth, in gravitropism, and in lateral root formation. Regulated by an auxin-induced protein turnover. Formation of heterodimers with ARF proteins may alter their ability to modulate early auxin response genes expression. When activated by cytokinin, restricts the expression of the PIN genes to the vascular transition zone. Induction of SHY2 in the vascular transition zone restricts BRX expression to down-regulate PIN3 and thus limit meristem growth, but proper SHY2 expression requires BRX. Involved in meristem growth and in determining its size. May participate in strigolactone signaling to regulate meristem size and lateral root formation.

Gene References into Functions

SHY2 is a pivotal negative regulator of root growth, which has been demonstrated to efficiently repress transcription of major auxin transport facilitators of the PIN-FORMED (PIN) gene family, thereby restricting polar auxin transport to the root tip and in consequence auxin-driven primary root growth. Taken together, our results disclose the central low-energy activated SnRK1-C/S1-bZIP signalling module as gateway to PMID: 28158182
DA1-related protein 2 (DAR2) acts downstream of cytokinin and SHY2 but upstream of PLT1/2 to affect root meristem size. PMID: 23518585
Strigolactone signaling involves SHY2 protein activity in roots. PMID: 23425316
The shy2 mutations strongly elevate endogenous indole-3-acetic acid level in the roots. PMID: 22527388
Data suggest a model in which the regulatory interactions favor BRX expression in the early proximal meristem and SHY2 prevails because of supplementary cytokinin induction in the later distal meristem. PMID: 21149702

Hide All

Subcellular Location

Nucleus.

Protein Families

Aux/IAA family

Tissue Specificity

Highly expressed in stems and flowers. Expressed in hypocotyls, cotyledons and leaves, but barely detected in roots. Expressed in root tips. In the root meristem, specifically detected at the vascular tissue transition zone.

Database Links

KEGG: ath:AT1G04240

STRING: 3702.AT1G04240.1

UniGene: At.20801

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-EP653623DOA
Abbreviation	Recombinant Mouse-ear cress IAA3 protein
MSDS	MSDS Datasheet
Size	$256
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Arabidopsis thaliana Auxin-responsive protein IAA3 (IAA3)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage