Recombinant Arabidopsis thaliana EPIDERMAL PATTERNING FACTOR-like protein 9 (EPFL9)

In Stock
Code CSB-EP879855DOA
Abbreviation Recombinant Mouse-ear cress EPFL9 protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
EPFL9
Uniprot No.
Research Area
Cardiovascular
Alternative Names
EPFL9; STOMAGEN; At4g12970; F25G13.60EPIDERMAL PATTERNING FACTOR-like protein 9; EPF-like protein 9) [Cleaved into: Stomagen]
Species
Arabidopsis thaliana (Mouse-ear cress)
Source
E.coli
Expression Region
32-102aa
Target Protein Sequence
SRPRSIENTVSLLPQVHLLNSRRRHMIGSTAPTCTYNECRGCRYKCRAEQVPVEGNDPINSAYHYRCVCHR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
14.2 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Arabidopsis thaliana EPIDERMAL PATTERNING FACTOR-like protein 9 (EPFL9) is produced using an E. coli expression system and includes the mature protein region from amino acids 32 to 102. The product comes with an N-terminal 10xHis-tag, which streamlines purification and detection processes. SDS-PAGE analysis confirms the protein reaches greater than 85% purity, suggesting it provides reliable material for research applications.

EPFL9 belongs to the EPIDERMAL PATTERNING FACTOR-like family in Arabidopsis thaliana. This family appears to play a crucial role in regulating stomatal development and patterning in plants. The protein seems particularly relevant for research aimed at understanding epidermal cell differentiation mechanisms and intercellular signaling pathways in plant biology. Many researchers find this protein useful when studying plant growth and development.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

EPFL9 is a plant signaling peptide that typically requires proper disulfide bond formation and specific tertiary structure for its biological activity in epidermal patterning. E. coli expression systems often struggle with the correct folding of small eukaryotic signaling proteins that require specific post-translational modifications or oxidative folding environments. The relatively large 10xHis tag (compared to the small mature protein size of 70aa) may significantly interfere with the protein's native conformation and functional domains. No validation data (e.g., receptor binding assays, circular dichroism) are provided. Therefore, the protein's folding status and bioactivity cannot be confirmed and are likely compromised.

1. Protein-Protein Interaction Studies Using Pull-Down Assays

This application carries substantial risk without folding validation. If correctly folded, the His-tagged EPFL9 could theoretically be used to identify binding partners, but the large tag may sterically hinder proper interactions even with correct folding. More realistically, if misfolded (probable in E. coli), the protein will exhibit non-specific binding patterns that do not reflect biological interactions, leading to misleading conclusions about epidermal patterning mechanisms.

2. Antibody Development and Validation

This application remains feasible as antibody development relies on linear epitope recognition. The defined amino acid sequence and high purity support consistent immunization results. However, antibodies generated against potentially misfolded protein may not optimally recognize the native, properly folded EPFL9 in plant tissues, particularly for conformation-dependent epitopes important for biological function.

3. Biochemical Characterization and Structural Studies

This application requires proper folding validation. If correctly folded, the protein could be used for limited structural characterization. However, if misfolded, biophysical data would misrepresent the native protein's properties. The large His-tag relative to the small protein size may dominate the structural signals, making meaningful analysis of the native EPFL9 structure challenging.

4. Competitive Binding Assays with Related EPFL Family Members

This application is not recommended without folding and functional validation. Competitive binding studies require properly folded proteins with maintained structural integrity. The misfolded recombinant protein will not exhibit correct binding specificity or affinity, making comparative data with other EPFL proteins biologically irrelevant and potentially misleading for understanding functional relationships within this protein family.

Final Recommendation & Action Plan

This E. coli-expressed His-tagged EPFL9 is high-risk for functional studies due to the challenges of producing properly folded small signaling peptides in prokaryotic systems and the significant tag interference relative to the small protein size. Before any application, rigorous validation of protein folding must be performed using analytical methods such as circular dichroism spectroscopy to assess secondary structure, and functional validation through receptor binding assays if possible. For reliable results, consider alternative expression systems such as eukaryotic hosts (e.g., plant-based or insect cell systems) that better support proper disulfide bond formation and folding of plant signaling peptides. Antibody development can proceed with the understanding that resulting antibodies may require additional validation for native protein recognition in plant tissues. Competitive binding and interaction studies should be avoided unless proper folding and functionality are conclusively demonstrated.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Positively regulates stomatal density and patterning. Acts by competing with EPF2 (AC Q8LC53) for the same receptors, ERECTA (AC Q42371) and TMM (AC Q9SSD1). Not cleaved by the protease CRSP (AC Q9LNU1).
Gene References into Functions
  1. Analysis of gain and loss of function of STOMAGEN detailed its function as a positive regulator of stomatal formation on both sides of the leaf, not only in terms of stomatal density across the leaf surface but also in terms of their stomatal index. PMID: 26002974
  2. MONOPTEROS directly binds to the STOMAGEN promoter to suppress its expression in mesophyll and inhibit stomatal development. PMID: 25002510
  3. control of stomatal density by the STOMAGEN gene PMID: 23432385
  4. This study provides evidence of a mesophyll-derived positive regulator of stomatal development, called stomagen. [stomagen] PMID: 20010603
  5. We propose that stomagen is a mesophyll-to-epidermis signaling molecule that positively regulates stomatal density. [STOMAGEN] PMID: 20007289
  6. EPFL9 plays a role in controlling stomatal development.[EPFL9] PMID: 20149115

Show More

Hide All

Subcellular Location
Secreted, extracellular space, apoplast. Secreted.
Protein Families
Plant cysteine rich small secretory peptide family, Epidermal patterning factor subfamily
Tissue Specificity
Expressed in immature organs, including leaves, stems and flower buds, but not in roots, shoot apical meristem and petals. Detected in the mesophyll tissues but not in the epidermal tissues where stomata develop.
Database Links

KEGG: ath:AT4G12970

STRING: 3702.AT4G12970.1

UniGene: At.43880

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*