Home
Protein
Recombinant Protein
Recombinant Arabidopsis thaliana EPIDERMAL PATTERNING FACTOR-like protein 9 (EPFL9)

Recombinant Arabidopsis thaliana EPIDERMAL PATTERNING FACTOR-like protein 9 (EPFL9)

^{In Stock}

Code	CSB-EP879855DOA
MSDS	MSDS
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

EPFL9

Uniprot No.

Q9SV72

Research Area

Cardiovascular

Alternative Names

EPFL9; STOMAGEN; At4g12970; F25G13.60EPIDERMAL PATTERNING FACTOR-like protein 9; EPF-like protein 9) [Cleaved into: Stomagen]

Species

Arabidopsis thaliana (Mouse-ear cress)

Source

E.coli

Expression Region

32-102aa

Target Protein Sequence

SRPRSIENTVSLLPQVHLLNSRRRHMIGSTAPTCTYNECRGCRYKCRAEQVPVEGNDPINSAYHYRCVCHR
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

14.2 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Tris-based buffer，50% glycerol

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Positively regulates stomatal density and patterning. Acts by competing with EPF2 (AC Q8LC53) for the same receptors, ERECTA (AC Q42371) and TMM (AC Q9SSD1). Not cleaved by the protease CRSP (AC Q9LNU1).

Gene References into Functions

Analysis of gain and loss of function of STOMAGEN detailed its function as a positive regulator of stomatal formation on both sides of the leaf, not only in terms of stomatal density across the leaf surface but also in terms of their stomatal index. PMID: 26002974
MONOPTEROS directly binds to the STOMAGEN promoter to suppress its expression in mesophyll and inhibit stomatal development. PMID: 25002510
control of stomatal density by the STOMAGEN gene PMID: 23432385
This study provides evidence of a mesophyll-derived positive regulator of stomatal development, called stomagen. [stomagen] PMID: 20010603
We propose that stomagen is a mesophyll-to-epidermis signaling molecule that positively regulates stomatal density. [STOMAGEN] PMID: 20007289
EPFL9 plays a role in controlling stomatal development.[EPFL9] PMID: 20149115

Hide All

Subcellular Location

Secreted, extracellular space, apoplast. Secreted.

Protein Families

Plant cysteine rich small secretory peptide family, Epidermal patterning factor subfamily

Tissue Specificity

Expressed in immature organs, including leaves, stems and flower buds, but not in roots, shoot apical meristem and petals. Detected in the mesophyll tissues but not in the epidermal tissues where stomata develop.

Database Links

KEGG: ath:AT4G12970

STRING: 3702.AT4G12970.1

UniGene: At.43880

Promotions