Recombinant Arabidopsis thaliana EPIDERMAL PATTERNING FACTOR-like protein 9 (EPFL9)

Code CSB-YP879855DOA
Abbreviation Recombinant Mouse-ear cress EPFL9 protein
MSDS
Size $436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
EPFL9
Uniprot No.
Research Area
Cardiovascular
Alternative Names
EPFL9; STOMAGEN; At4g12970; F25G13.60EPIDERMAL PATTERNING FACTOR-like protein 9; EPF-like protein 9) [Cleaved into: Stomagen]
Species
Arabidopsis thaliana (Mouse-ear cress)
Source
Yeast
Expression Region
32-102aa
Target Protein Sequence
SRPRSIENTVSLLPQVHLLNSRRRHMIGSTAPTCTYNECRGCRYKCRAEQVPVEGNDPINSAYHYRCVCHR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
10.2 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
25-35 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Positively regulates stomatal density and patterning. Acts by competing with EPF2 (AC Q8LC53) for the same receptors, ERECTA (AC Q42371) and TMM (AC Q9SSD1). Not cleaved by the protease CRSP (AC Q9LNU1).
Gene References into Functions
  1. Analysis of gain and loss of function of STOMAGEN detailed its function as a positive regulator of stomatal formation on both sides of the leaf, not only in terms of stomatal density across the leaf surface but also in terms of their stomatal index. PMID: 26002974
  2. MONOPTEROS directly binds to the STOMAGEN promoter to suppress its expression in mesophyll and inhibit stomatal development. PMID: 25002510
  3. control of stomatal density by the STOMAGEN gene PMID: 23432385
  4. This study provides evidence of a mesophyll-derived positive regulator of stomatal development, called stomagen. [stomagen] PMID: 20010603
  5. We propose that stomagen is a mesophyll-to-epidermis signaling molecule that positively regulates stomatal density. [STOMAGEN] PMID: 20007289
  6. EPFL9 plays a role in controlling stomatal development.[EPFL9] PMID: 20149115

Show More

Hide All

Subcellular Location
Secreted, extracellular space, apoplast. Secreted.
Protein Families
Plant cysteine rich small secretory peptide family, Epidermal patterning factor subfamily
Tissue Specificity
Expressed in immature organs, including leaves, stems and flower buds, but not in roots, shoot apical meristem and petals. Detected in the mesophyll tissues but not in the epidermal tissues where stomata develop.
Database Links

KEGG: ath:AT4G12970

STRING: 3702.AT4G12970.1

UniGene: At.43880

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*