Recombinant Bordetella pertussis Serotype 3 fimbrial subunit (fim3)

In Stock
Code CSB-EP322971BUA
Abbreviation Recombinant Bordetella pertussis fim3 protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
fim3
Uniprot No.
Research Area
Others
Alternative Names
fim3; BP1568; Serotype 3 fimbrial subunit
Species
Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Source
E.coli
Expression Region
26-204aa
Target Protein Sequence
NDGTIVITGSISDQTCVIEEPSTLNHIKVVQLPKISKNALRNDGDTAGATPFDIKLKECPQALGALKLYFEPGITTNYDTGDLIAYKQTYNASGNGNLSTVSSATKAKGVEFRLANLNGQHIRMGTDKTTQAAQTFTGKVTNGSKSYTLRYLASYVKKPKEDVDAAQITSYVGFSVVYP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
35.2kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Bordetella pertussis Serotype 3 fimbrial subunit (fim3) gets produced in an E. coli expression system and contains the complete mature protein sequence from amino acids 26-204. The protein carries an N-terminal 6xHis-SUMO tag, which appears to help with purification while likely boosting stability. SDS-PAGE analysis shows the product achieves greater than 90% purity—a level that should work well for most research needs.

Fim3 represents a structural protein that makes up part of the fimbriae in Bordetella pertussis, the bug behind whooping cough. These fimbriae seem crucial for how bacteria stick to things, and they probably play a major role in causing disease by helping the organism latch onto host cells. Getting a handle on fim3's structure and what it does may be key to figuring out how bacterial infections work and possibly creating new treatments.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

The recombinant B. pertussis Fim3 protein is expressed in E. coli with an N-terminal 6xHis-SUMO tag, covering the mature protein sequence (26-204aa) with >90% purity. As a bacterial fimbrial subunit, Fim3 naturally forms polymerized structures (fimbriae) and may require specific bacterial chaperones for correct folding. The SUMO tag generally enhances solubility and may improve folding efficiency in E. coli, but the protein's biological activity (specifically, its ability to polymerize or bind to receptors) remains unverified. While the high purity suggests good expression, the presence of the large SUMO tag (≈100 amino acids) may sterically hinder proper folding or intermolecular interactions essential for Fim3's native function. Without experimental validation, we cannot assume correct folding or bioactivity.

1. Antibody Development and Immunological Studies

This application is generally suitable. The recombinant Fim3 can serve as an immunogen for antibody production since antibodies often recognize linear epitopes. The His-SUMO tag facilitates purification. However, antibodies generated may not recognize conformation-dependent epitopes of the native, properly folded Fim3 in B. pertussis. Validate antibody specificity against native fimbriae or bacterial cells.

2. Protein-Protein Interaction Studies

Use with caution. The His-SUMO tag enables pull-down assays, but the large tag or potential misfolding may cause non-physiological interactions. If Fim3 requires proper folding/polymerization for native interactions (e.g., with host receptors or other fimbrial subunits), results may be misleading. SUMO protease cleavage can remove the tag, but folding post-cleavage is uncertain. Validate interactions with native Fim3 or genetic methods.

3. Biochemical Characterization and Stability Studies

This application is feasible for basic physicochemical properties (e.g., molecular weight, thermal stability). However, structural studies (e.g., circular dichroism) may reflect the SUMO-tagged protein's properties rather than native Fim3's. Data may not represent the natural fimbrial subunit's behavior, especially if polymerization capability is compromised. Interpret results in the context of the tagged protein.

4. Vaccine Research and Immunogenicity Assessment

This application requires significant modification. The His-SUMO tag is highly immunogenic and may dominate the immune response, reducing Fim3-specific immunity. Furthermore, a misfolded or non-polymerizing Fim3 may not elicit antibodies recognizing native fimbriae. Always remove the SUMO tag and verify the protein's native conformation before immunogenicity studies. Compare immune responses with native fimbriae or tag-free Fim3.

Final Recommendation & Action Plan

Prioritize experimental validation of the protein's folding and functionality before any functional applications. First, use SUMO protease to remove the tag and purify tag-free Fim3. Then, assess folding via circular dichroism (secondary structure) and native PAGE/Size Exclusion Chromatography (quaternary structure/polymerization). Validate functionality through receptor-binding assays or immunization studies, comparing with known native Fim3. For antibody production, proceed but characterize epitopes. For vaccine studies, use only tag-free, properly folded protein. Always include appropriate controls (e.g., native fimbriae) to ensure biological relevance.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Bordetella pertussis is the causative agent of whooping cough. An essential step in the disease process is the attachment of the bacteria to the ciliated epithelium of the respiratory tract, enabling the organism to resist normal host-clearance mechanisms. It is unclear which bacterial cell surface component are responsible for adherence but the fimbriae of B.pertussis are prime candidates for being involved in this process.
Subcellular Location
Fimbrium. Note=Pili structure on the cell surface.
Protein Families
Fimbrial protein family
Database Links

KEGG: bpe:BP1568

STRING: 257313.BP1568

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*