Recombinant Borreliella burgdorferi Outer surface protein A (ospA)

In Stock
Code CSB-EP363424BIO
Abbreviation Recombinant Borreliella burgdorferi ospA protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
ospA
Uniprot No.
Research Area
others
Alternative Names
ospA; Outer surface protein A
Species
Borreliella burgdorferi (Lyme disease spirochete) (Borrelia burgdorferi)
Source
E.coli
Expression Region
17-273aa
Target Protein Sequence
CKQNVSSLDEKNSASVDLPGEMKVLVSKEKDKDGKYSLKATVDKIELKGTSDKDNGSGVLEGTKDDKSKAKLTIADDLSKTTFELFKEDGKTLVSRKVSSKDKTSTDEMFNEKGELSAKTMTRENGTKLEYTEMKSDGTGKAKEVLKNFTLEGKVANDKVTLEVKEGTVTLSKEIAKSGEVTVALNDTNTTQATKKTGAWDSKTSTLTISVNSKKTTQLVFTKQDTITVQKYDSAGTNLEGTAVEIKTLDELKNALK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
32.9 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The production of recombinant Borreliella burgdorferi Outer surface protein A (ospA) in E. coli involves several key steps. First, the gene encoding the full length of mature ospA protein (17-273aa) is co-inserted into an expression vector with an N-terminal 10xHis-tag and C-terminal Myc-tag gene and introduced into E. coli cells. The bacteria are cultured under conditions that promote protein expression. After sufficient growth, the cells are lysed to release the recombinant ospA protein. Purification typically involves the affinity chromatography technique. Protein purity is assessed using SDS-PAGE. Its purity is over 85% as determined by SDS-PAGE.

Borrelia burgdorferi OspA is crucial in this viral transmission and infection.
It is one of the major outer surface membrane proteins recognized by antibodies in patients with Lyme borreliosis [1]. OspA, along with OspC, is selectively produced and functionally significant in different stages of the Borrelia burgdorferi life cycle, with OspA being important in the tick vector and OspC in the mammalian host [2]. The expression of OspA is altered during the transmission of Borrelia burgdorferi from ticks to mammalian hosts, indicating its role in the infectivity process [3]. Furthermore, studies have highlighted the significance of outer surface proteins, including OspA, in the evasion of the complement system, a crucial aspect of Borrelia burgdorferi's pathogenicity [4].

References:
[1] W. Schubach, S. Mudri, R. Dattwyler, & B. Luft, Mapping antibody-binding domains of the major outer surface membrane protein (ospa) of borrelia burgdorferi, Infection and Immunity, vol. 59, no. 6, p. 1911-1915, 1991. https://doi.org/10.1128/iai.59.6.1911-1915.1991
[2] S. Srivastava and A. Silva, Reciprocal expression of ospa and ospc in single cells of borrelia burgdorferi, Journal of Bacteriology, vol. 190, no. 10, p. 3429-3433, 2008. https://doi.org/10.1128/jb.00085-08
[3] R. Johns, D. Sonenshine, & W. Hynes, Enhancement of ospc expression byborrelia burgdorferiin the presence of tick hemolymph, Fems Microbiology Letters, vol. 193, no. 1, p. 137-141, 2000. https://doi.org/10.1111/j.1574-6968.2000.tb09415.x
[4] R. Garrigues, S. Thomas, J. Leong, & B. Garcia, Outer surface lipoproteins from the lyme disease spirochete exploit the molecular switch mechanism of the complement protease c1s,, 2022. https://doi.org/10.1101/2022.08.17.504303

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Subcellular Location
Cell outer membrane; Lipid-anchor.
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*