Purity
Greater than 85% as determined by SDS-PAGE.
Alternative Names
ospA; Outer surface protein A
Species
Borreliella burgdorferi (Lyme disease spirochete) (Borrelia burgdorferi)
Expression Region
17-273aa
Target Protein Sequence
CKQNVSSLDEKNSASVDLPGEMKVLVSKEKDKDGKYSLKATVDKIELKGTSDKDNGSGVLEGTKDDKSKAKLTIADDLSKTTFELFKEDGKTLVSRKVSSKDKTSTDEMFNEKGELSAKTMTRENGTKLEYTEMKSDGTGKAKEVLKNFTLEGKVANDKVTLEVKEGTVTLSKEIAKSGEVTVALNDTNTTQATKKTGAWDSKTSTLTISVNSKKTTQLVFTKQDTITVQKYDSAGTNLEGTAVEIKTLDELKNALK
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Discover the potential of recombinant Borreliella burgdorferi Outer Surface Protein A (ospA) in your research endeavors. This full-length mature protein, spanning the 17-273aa region, is derived from Borreliella burgdorferi, the causative agent of Lyme disease. Produced in E.coli, this protein is perfect for applications requiring high-quality recombinant materials. Featuring an N-terminal 10xHis-tag and C-terminal Myc-tag, ospA is conveniently tagged for purification purposes without affecting the protein's functionality.
Boasting a purity greater than 85% as determined by SDS-PAGE, this lyophilized powder is ready to be incorporated into a variety of experimental settings, helping you uncover new insights in the realm of Lyme disease research.
