Name: Recombinant Bovine Agouti-signaling protein (ASIP)
Brand: CUSABIO
SKU: CSB-EP639982BO

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

ASIP

Uniprot No.

Q29414

Research Area

Neuroscience

Alternative Names

ASIP; Agouti-signaling protein; ASP; Agouti switch protein

Species

Bos taurus (Bovine)

Source

E.coli

Expression Region

23-133aa

Target Protein Sequence

HLAPEEKPRDERNLKNNSSMNLLDFPSVSIVALNKKSKKISRNEAEKKKRPSKRKAPMKNVARTRPPPPTPCVATRDSCKPPAPACCDPCAFCQCRFFRSACSCRVLNPTC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

28.4kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

I have a question. We would like to use rec. ASIP protein as a treatment in the cell culture. Is this protein (CSB-EP639982BO) clean enough for cell culture? I notice this protein is generated from E.coli.

Thanks for your inquiry. We suggest the Eukryon expression system, and endotoxin removal & asepsis process.
The distribute price is as follow:
Recombinant Bovine Agouti-signaling protein(ASIP)
CSB-YP639982BO >> Yeast
CSB-EP639982BO >> E.coli
CSB-BP639982BO >> Baculovirus
CSB-MP639982BO >> Mammalian cell
Express Region:23-133aa；mature full length protein.
Tag inforormation:EP:N-terminal 6xHis-SUMO-tagged；BP,MP:N-terminal 10xHis-tagged and C-terminal Myc-tagged；YP:N-terminal 6xHis-tagged
Express sequence:

HLAPEEKPRDERNLKNNSSMNLLDFPSVSIVALNKKSKKISRNEAEKKKRPSKRKAPMKNVARTRPPPPTPCVATRDSCKPPAPACCDPCAFCQCRFFRSACSCRVLNPTC

Target Background

Function

Involved in the regulation of melanogenesis. The binding of ASP to MC1R precludes alpha-MSH initiated signaling and thus blocks production of cAMP, leading to a down-regulation of eumelanogenesis (brown/black pigment) and thus increasing synthesis of pheomelanin (yellow/red pigment).

Gene References into Functions

Our results provide evidence for a widespread expression of ASIP in bovine tissues at mRNA and, for the first time, at protein level. PMID: 22530003
Possible consequences of Abr (agouti gene mutated by insertion of LINE element)for meat and milk production in cattle. PMID: 16827753

Subcellular Location

Secreted.

Database Links

KEGG: bta:404192

STRING: 9913.ENSBTAP00000045382

UniGene: Bt.89130

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-EP639982BO
Abbreviation	Recombinant Bovine ASIP protein
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Bovine Agouti-signaling protein (ASIP)

Product Details

Citations

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage