Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
| Code | CSB-EP639982BO |
| Abbreviation | Recombinant Bovine ASIP protein |
| MSDS | |
| Size | US$388 |
| Order now | |
| Image | |
| Have Questions? | Leave a Message or Start an on-line Chat |
There are currently no reviews for this product.
I have a question. We would like to use rec. ASIP protein as a treatment in the cell culture. Is this protein (CSB-EP639982BO) clean enough for cell culture? I notice this protein is generated from E.coli.
HLAPEEKPRDERNLKNNSSMNLLDFPSVSIVALNKKSKKISRNEAEKKKRPSKRKAPMKNVARTRPPPPTPCVATRDSCKPPAPACCDPCAFCQCRFFRSACSCRVLNPTC