Recombinant Bovine Insulin-like 3 (INSL3), partial

In Stock
Code CSB-EP011747BO
Abbreviation Recombinant Bovine INSL3 protein, partial
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
INSL3
Uniprot No.
Research Area
Others
Species
Bos taurus (Bovine)
Source
E.coli
Expression Region
22-66aa
Target Protein Sequence
GPAAAQEAPEKLCGHHFVRALVRLCGGPRWSSEEDGRPVAGGDRE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
20.1 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-KSI-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant Bovine INSL3 protein is produced by manipulating the expression of specific genes in e.coli cells. A DNA sequence encoding the Bovine INSL3 protein (22-66aa) is fused to an expression vector and subsequently transformed into e.coli cells. The cells that successfully integrate the vector are selected and cultured to induce the expression of the desired protein. A N-terminal 6xHis-KSI tag is attached to the protein. The recombinant Bovine INSL3 protein protein is then purified using affinity purification, achieving a purity level of over 90%, as confirmed by SDS-PAGE analysis.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Seems to play a role in testicular function. May be a trophic hormone with a role in testicular descent in fetal life. Is a ligand for LGR8 receptor.
Gene References into Functions
  1. These results suggest that reduced secretions of IGF-I, INSL3, and inhibin surrounding puberty may be associated with semen aberration in beef bulls. PMID: 29597124
  2. These results suggested an acute regulation of INSL3 by luteinizing hormone (LH) because INSL3 concentrations increased immediately after endogenous and exogenous LH stimulation. PMID: 26318230
  3. INSL3 plays a luteotropic role as a local regulator in the bovine corpus luteum. PMID: 23220928
  4. BMP6 has a role in downregulating INSL3 and CYP17A1 and other proteins that modulate ovarian androgen production PMID: 23530236
  5. The likely role of INSL3 as an important intrafollicular modulator of thecal interna cell function/steroidogenesis. PMID: 23546605
  6. INSL3 provides the first example of a gender-specific fetal hormone with the potential to influence both placental and maternal physiology PMID: 21603619
  7. relaxin-like factor mRNA was highly expressed in the corpus luteum on days 7 and 14 of pregnancy PMID: 15956752

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Insulin family
Tissue Specificity
Expressed exclusively in Leydig cells of the testis.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*