Purity
Greater than 85% as determined by SDS-PAGE.
Alternative Names
FBA1; CAALFM_C401750CA; CaO19.12088; CaO19.4618Fructose-bisphosphate aldolase; FBP aldolase; FBPA; EC 4.1.2.13; 37 kDa major allergen; Fructose-1,6-bisphosphate aldolase; IgE-binding allergen
Species
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Expression Region
2-359aa
Target Protein Sequence
APPAVLSKSGVIYGKDVKDLFDYAQEKGFAIPAINVTSSSTVVAALEAARDNKAPIILQTSQGGAAYFAGKGVDNKDQAASIAGSIAAAHYIRAIAPTYGIPVVLHTDHCAKKLLPWFDGMLKADEEFFAKTGTPLFSSHMLDLSEETDDENIATCAKYFERMAKMGQWLEMEIGITGGEEDGVNNEHVEKDALYTSPETVFAVYESLHKISPNFSIAAAFGNVHGVYKPGNVQLRPEILGDHQVYAKKQIGTDAKHPLYLVFHGGSGSTQEEFNTAIKNGVVKVNLDTDCQYAYLTGIRDYVTNKIEYLKAPVGNPEGADKPNKKYFDPRVWVREGEKTMSKRIAEALDIFHTKGQL
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Expressing the recombinant Candida albicans (strain SC5314 / ATCC MYA-2876) FBA1 protein in e.coli cells involves inserting a DNA fragment encoding the Candida albicans (strain SC5314 / ATCC MYA-2876) FBA1 protein (2-359aa) into a plasmid vector and transferring it to the e.coli cells. Positive cells are screened, cultured, and induced to express the FBA1 protein. The protein carries a N-terminal 10xHis tag and C-terminal Myc tag. The cells are lysed to collect the recombinant Candida albicans (strain SC5314 / ATCC MYA-2876) FBA1 protein, which is purified through affinity purification and then identified using SDS-PAGE and subsequent staining of the gel with Coomassie Brilliant Blue. The purity of the resulting recombinant Candida albicans (strain SC5314 / ATCC MYA-2876) FBA1 protein exceeds 85%.