Home
Protein
Recombinant Proteins
Recombinant Candida albicans Fructose-bisphosphate aldolase (FBA1)

Recombinant Candida albicans Fructose-bisphosphate aldolase (FBA1)

^{In Stock}

Code	CSB-EP891473CZD
Abbreviation	Recombinant Candida albicans FBA1 protein
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

FBA1

Uniprot No.

Q9URB4

Research Area

Others

Alternative Names

FBA1; CAALFM_C401750CA; CaO19.12088; CaO19.4618Fructose-bisphosphate aldolase; FBP aldolase; FBPA; EC 4.1.2.13; 37 kDa major allergen; Fructose-1,6-bisphosphate aldolase; IgE-binding allergen

Species

Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)

Source

E.coli

Expression Region

2-359aa

Target Protein Sequence

APPAVLSKSGVIYGKDVKDLFDYAQEKGFAIPAINVTSSSTVVAALEAARDNKAPIILQTSQGGAAYFAGKGVDNKDQAASIAGSIAAAHYIRAIAPTYGIPVVLHTDHCAKKLLPWFDGMLKADEEFFAKTGTPLFSSHMLDLSEETDDENIATCAKYFERMAKMGQWLEMEIGITGGEEDGVNNEHVEKDALYTSPETVFAVYESLHKISPNFSIAAAFGNVHGVYKPGNVQLRPEILGDHQVYAKKQIGTDAKHPLYLVFHGGSGSTQEEFNTAIKNGVVKVNLDTDCQYAYLTGIRDYVTNKIEYLKAPVGNPEGADKPNKKYFDPRVWVREGEKTMSKRIAEALDIFHTKGQL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

46.5 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Expressing the recombinant Candida albicans (strain SC5314 / ATCC MYA-2876) FBA1 protein in e.coli cells involves inserting a DNA fragment encoding the Candida albicans (strain SC5314 / ATCC MYA-2876) FBA1 protein (2-359aa) into a plasmid vector and transferring it to the e.coli cells. Positive cells are screened, cultured, and induced to express the FBA1 protein. The protein carries a N-terminal 10xHis tag and C-terminal Myc tag. The cells are lysed to collect the recombinant Candida albicans (strain SC5314 / ATCC MYA-2876) FBA1 protein, which is purified through affinity purification and then identified using SDS-PAGE and subsequent staining of the gel with Coomassie Brilliant Blue. The purity of the resulting recombinant Candida albicans (strain SC5314 / ATCC MYA-2876) FBA1 protein exceeds 85%.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Catalyzes the aldol condensation of dihydroxyacetone phosphate (DHAP or glycerone-phosphate) with glyceraldehyde 3-phosphate (G3P) to form fructose 1,6-bisphosphate (FBP) in gluconeogenesis and the reverse reaction in glycolysis.

Gene References into Functions

To test if Fba1p is an antifungal target, the effects of depleting this enzyme in Candida albicans was investigated using a methionine/cysteine-conditional mutant (MET3-FBA1/fba1); and it was found that Fba1p is required for the growth of C. albicans. PMID: 16896220

Subcellular Location

Cytoplasm.

Protein Families

Class II fructose-bisphosphate aldolase family

Database Links

KEGG: cal:CAALFM_C401750CA

Promotions