Recombinant Candida albicans Fructose-bisphosphate aldolase (FBA1)

In Stock
Code CSB-EP891473CZD
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
FBA1
Uniprot No.
Research Area
Others
Alternative Names
FBA1; CAALFM_C401750CA; CaO19.12088; CaO19.4618Fructose-bisphosphate aldolase; FBP aldolase; FBPA; EC 4.1.2.13; 37 kDa major allergen; Fructose-1,6-bisphosphate aldolase; IgE-binding allergen
Species
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Source
E.coli
Expression Region
2-359aa
Target Protein Sequence
APPAVLSKSGVIYGKDVKDLFDYAQEKGFAIPAINVTSSSTVVAALEAARDNKAPIILQTSQGGAAYFAGKGVDNKDQAASIAGSIAAAHYIRAIAPTYGIPVVLHTDHCAKKLLPWFDGMLKADEEFFAKTGTPLFSSHMLDLSEETDDENIATCAKYFERMAKMGQWLEMEIGITGGEEDGVNNEHVEKDALYTSPETVFAVYESLHKISPNFSIAAAFGNVHGVYKPGNVQLRPEILGDHQVYAKKQIGTDAKHPLYLVFHGGSGSTQEEFNTAIKNGVVKVNLDTDCQYAYLTGIRDYVTNKIEYLKAPVGNPEGADKPNKKYFDPRVWVREGEKTMSKRIAEALDIFHTKGQL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
46.5 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Expressing the recombinant Candida albicans (strain SC5314 / ATCC MYA-2876) FBA1 protein in e.coli cells involves inserting a DNA fragment encoding the Candida albicans (strain SC5314 / ATCC MYA-2876) FBA1 protein (2-359aa) into a plasmid vector and transferring it to the e.coli cells. Positive cells are screened, cultured, and induced to express the FBA1 protein. The protein carries a N-terminal 10xHis tag and C-terminal Myc tag. The cells are lysed to collect the recombinant Candida albicans (strain SC5314 / ATCC MYA-2876) FBA1 protein, which is purified through affinity purification and then identified using SDS-PAGE and subsequent staining of the gel with Coomassie Brilliant Blue. The purity of the resulting recombinant Candida albicans (strain SC5314 / ATCC MYA-2876) FBA1 protein exceeds 85%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the aldol condensation of dihydroxyacetone phosphate (DHAP or glycerone-phosphate) with glyceraldehyde 3-phosphate (G3P) to form fructose 1,6-bisphosphate (FBP) in gluconeogenesis and the reverse reaction in glycolysis.
Gene References into Functions
  1. To test if Fba1p is an antifungal target, the effects of depleting this enzyme in Candida albicans was investigated using a methionine/cysteine-conditional mutant (MET3-FBA1/fba1); and it was found that Fba1p is required for the growth of C. albicans. PMID: 16896220
Subcellular Location
Cytoplasm.
Protein Families
Class II fructose-bisphosphate aldolase family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*