Recombinant Chicken Serine/threonine-protein kinase STK11(STK11)

Product Type Recombinant Protein
Uniprot No. Q0GGW5
Abbreviation STK11
Species Gallus gallus (Chicken)
Gene Names STK11
Protein Names Recommended name: Serine/threonine-protein kinase STK11 EC= 2.7.11.1 Alternative name(s): Liver kinase B1 homolog Short name= LKB1
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Target Details This gene, which encodes a member of the serine/threonine kinase family, regulates cell polarity and functions as a tumor suppressor. Mutations in this gene have been associated with Peutz-Jeghers syndrome, an autosomal dominant disorder characterized by the growth of polyps in the gastrointestinal tract, pigmented macules on the skin and mouth, and other neoplasms. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized.
HGNC 11389
RGD 1308653
MGI 1341870
Function Tumor suppressor serine/threonine-protein kinase that controls the activity of AMP-activated protein kinase (AMPK) family members, thereby playing a role in various processes such as cell metabolism, cell polarity, apoptosis and DNA damage response. Acts by phosphorylating the T-loop of AMPK family proteins, leading to promote their activity (By similarity).
Subcellular Location Nucleus, Cytoplasm
Protein Families Protein kinase superfamily, CAMK Ser/Thr protein kinase family, LKB1 subfamily
Tissue Specificity Ubiquitously expressed in all tissues tested. High levels were observed in duodenum and skeletal muscle, lower levels in liver and pancreas.
Database Links

KEGG: gga:420105

STRING: 9031.ENSGALP00000004239

UniGene: Gga.12596

Pathway mTOR signaling pathway
PI3K-Akt signaling pathway
Autophagy
MAPK Erk pathway
Adipocytokine signaling pathway
AMPK signaling
FoxO signaling pathway

Product Details for Different Expression Systems

Product Name Recombinant Chicken Serine/threonine-protein kinase STK11(STK11),Yeast
Code CSB-YP603578CH
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MDMQESQQLGMFGESELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSY GKVKEMLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNE EKQKMYMVMEYCVCGMQEMLDSVPEKRFPVFQAHGYFCQLIDGLEYLHSQGIVHKDIKPG NLLLTTNGTLKISDLGVAEALHPFAEDDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWS AGVTLYNITTGLYPFEGDNIYKLFENIGKGDFTIPEDCGPPLSDLLRGMLEYDPAKRFSI QQIRQHNWFRKKHAQAETLVPIPPSPETKDKWRSMTAVPYLEDLHGYNEDEDDDLYDIED DIIYTQDFTVPGQVPEEEAGQNGQSRGRGLPKAICMNGTEPGQLSTKSKAERRASASSNP SRKACSASSKIRKLSTCKQQ
Expression Region 1-440
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Chicken Serine/threonine-protein kinase STK11(STK11),E.coli
Code CSB-EP603578CH
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MDMQESQQLGMFGESELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSY GKVKEMLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNE EKQKMYMVMEYCVCGMQEMLDSVPEKRFPVFQAHGYFCQLIDGLEYLHSQGIVHKDIKPG NLLLTTNGTLKISDLGVAEALHPFAEDDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWS AGVTLYNITTGLYPFEGDNIYKLFENIGKGDFTIPEDCGPPLSDLLRGMLEYDPAKRFSI QQIRQHNWFRKKHAQAETLVPIPPSPETKDKWRSMTAVPYLEDLHGYNEDEDDDLYDIED DIIYTQDFTVPGQVPEEEAGQNGQSRGRGLPKAICMNGTEPGQLSTKSKAERRASASSNP SRKACSASSKIRKLSTCKQQ
Expression Region 1-440
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Chicken Serine/threonine-protein kinase STK11(STK11),Baculovirus
Code CSB-BP603578CH
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MDMQESQQLGMFGESELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSY GKVKEMLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNE EKQKMYMVMEYCVCGMQEMLDSVPEKRFPVFQAHGYFCQLIDGLEYLHSQGIVHKDIKPG NLLLTTNGTLKISDLGVAEALHPFAEDDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWS AGVTLYNITTGLYPFEGDNIYKLFENIGKGDFTIPEDCGPPLSDLLRGMLEYDPAKRFSI QQIRQHNWFRKKHAQAETLVPIPPSPETKDKWRSMTAVPYLEDLHGYNEDEDDDLYDIED DIIYTQDFTVPGQVPEEEAGQNGQSRGRGLPKAICMNGTEPGQLSTKSKAERRASASSNP SRKACSASSKIRKLSTCKQQ
Expression Region 1-440
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Chicken Serine/threonine-protein kinase STK11(STK11),Mammalian cell
Code CSB-MP603578CH
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MDMQESQQLGMFGESELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSY GKVKEMLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNE EKQKMYMVMEYCVCGMQEMLDSVPEKRFPVFQAHGYFCQLIDGLEYLHSQGIVHKDIKPG NLLLTTNGTLKISDLGVAEALHPFAEDDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWS AGVTLYNITTGLYPFEGDNIYKLFENIGKGDFTIPEDCGPPLSDLLRGMLEYDPAKRFSI QQIRQHNWFRKKHAQAETLVPIPPSPETKDKWRSMTAVPYLEDLHGYNEDEDDDLYDIED DIIYTQDFTVPGQVPEEEAGQNGQSRGRGLPKAICMNGTEPGQLSTKSKAERRASASSNP SRKACSASSKIRKLSTCKQQ
Expression Region 1-440
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.