Recombinant Chicken Serine/threonine-protein kinase STK11(STK11)

Code CSB-YP603578CH
Size Pls inquire other sizes
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP603578CH
Size Pls inquire other sizes
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP603578CH-B
Size Pls inquire other sizes
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP603578CH
Size Pls inquire other sizes
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP603578CH
Size Pls inquire other sizes
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity >85% (SDS-PAGE)
Target Names STK11
Uniprot No. Q0GGW5
Alternative Names STK11; Serine/threonine-protein kinase STK11; EC 2.7.11.1; Liver kinase B1 homolog; LKB1
Species Gallus gallus (Chicken)
Expression Region 1-440
Target Protein Sequence MDMQESQQLGMFGESELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSY GKVKEMLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNE EKQKMYMVMEYCVCGMQEMLDSVPEKRFPVFQAHGYFCQLIDGLEYLHSQGIVHKDIKPG NLLLTTNGTLKISDLGVAEALHPFAEDDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWS AGVTLYNITTGLYPFEGDNIYKLFENIGKGDFTIPEDCGPPLSDLLRGMLEYDPAKRFSI QQIRQHNWFRKKHAQAETLVPIPPSPETKDKWRSMTAVPYLEDLHGYNEDEDDDLYDIED DIIYTQDFTVPGQVPEEEAGQNGQSRGRGLPKAICMNGTEPGQLSTKSKAERRASASSNP SRKACSASSKIRKLSTCKQQ
Protein Length full length protein
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Target Data

Function Tumor suppressor serine/threonine-protein kinase that controls the activity of AMP-activated protein kinase (AMPK) family members, thereby playing a role in various processes such as cell metabolism, cell polarity, apoptosis and DNA damage response. Acts by phosphorylating the T-loop of AMPK family proteins, leading to promote their activity (By similarity).
Gene References into Functions
  1. silencing of the LKB1 tumor suppressor affects the delamination of pre-migratory cephalic neural crest cells from the neural primordium as well as their polarization and survival, thus resulting in severe facial and brain defects PMID: 27527806
Subcellular Location Nucleus, Cytoplasm
Protein Families Protein kinase superfamily, CAMK Ser/Thr protein kinase family, LKB1 subfamily
Tissue Specificity Ubiquitously expressed in all tissues tested. High levels were observed in duodenum and skeletal muscle, lower levels in liver and pancreas.
Database Links

KEGG: gga:420105

STRING: 9031.ENSGALP00000004239

UniGene: Gga.12596

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1