Name: Recombinant Clostridium botulinum ATP-dependent Clp protease proteolytic subunit (clpP)
Brand: CUSABIO
SKU: CSB-EP401627CWV

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

clpP

Uniprot No.

A5I6W1

Research Area

Microbiology

Alternative Names

clpP; CBO3231; CLC_3142ATP-dependent Clp protease proteolytic subunit; EC 3.4.21.92; Endopeptidase Clp

Species

Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)

Source

E.coli

Expression Region

1-194aa

Target Protein Sequence

MSLVPVVVEQTNRGERSYDIYSRLLKDRIIMLSEEVNDTTASLIVAQLLFLEAEDPDKDIHLYINSPGGSITSGMAIYDTMQYIKPDVSTICVGMAASMGAFLLAAGAKGKRYALPNSEVMIHQPLGGFRGQATDIGIHAERILKMKKKLNTILSDRTGKPLEQVELDTERDHFLSAEEAKEYGLIDEVIDKKK
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

37.5kDa

Protein Length

Full Length

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Enhance your microbiology research with our Recombinant Clostridium botulinum ATP-dependent Clp Protease Proteolytic Subunit, a crucial component of the Clp protease system involved in protein quality control and stress response in this pathogenic bacterium. Sourced from Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A), this recombinant protein is produced in E. coli for consistent quality and performance in your research applications.

Our Recombinant Clostridium botulinum ClpP protein provides the full length of the proteolytic subunit, with an expression region of 1-194aa, ensuring comprehensive functionality for your studies. The N-terminal 6xHis-SUMO-tag facilitates seamless purification and detection while preserving the protein's biological activity. With greater than 90% purity as determined by SDS-PAGE, our Recombinant Clostridium botulinum ClpP protein guarantees exceptional quality for your experiments.

Available as a lyophilized powder for convenient storage and reconstitution, the Recombinant Clostridium botulinum ATP-dependent Clp Protease Proteolytic Subunit is an outstanding choice for researchers exploring the intricate processes of protein degradation and stress response in this notorious bacterium. Trust our high-quality ClpP protein to elevate your research in the field of microbiology.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

I am writing to you regarding the product #CSB-EP401627CWV Recombinant Clostridium botulinum ATP-dependent Clp protease proteolytic subunit (clpP).
Could you, please, let me know whether the activity of the protein has been tested and with what substrate/assay? And does it require cofactors and accessory proteins to be present?
I intend to assess it on a small peptide but from my prior information it should not require these in the assay.

Thanks for your inquiry.
Recombinant Clostridium botulinum ATP-dependent Clp protease proteolytic subunit(clpP)
CSB-YP401627CWV >> Yeast
CSB-EP401627CWV >> E.coli
CSB-BP401627CWV >> Baculovirus
CSB-MP401627CWV >> Mammalian cell
Expression region: 1-194aa; Full length;
Tag information: EP: N-terminal 6xHis-SUMO-tagged； BP&MP:N-terminal 10xHis-tagged and C-terminal Myc-tagged；YP:N-terminal 6xHis-tagged
Sequence:

MSLVPVVVEQTNRGERSYDIYSRLLKDRIIMLSEEVNDTTASLIVAQLLFLEAEDPDKDIHLYINSPGGSITSGMAIYDTMQYIKPDVSTICVGMAASMGAFLLAAGAKGKRYALPNSEVMIHQPLGGFRGQATDIGIHAERILKMKKKLNTILSDRTGKPLEQVELDTERDHFLSAEEAKEYGLIDEVIDKKK

We haven't tested the activity of this protein, so cannot 100% guaranteed. What we provide is the full length of mature protein, and it is purified under mild condition. It should be active in theory.
Here is a reference link:
https://www.uniprot.org/uniprot/A5I6W1
Hydrolysis of proteins to small peptides in the presence of ATP and magnesium. Alpha-casein is the usual test substrate. In the absence of ATP, only oligopeptides shorter than five residues are hydrolyzed (such as succinyl-Leu-Tyr-|-NHMec; and Leu-Tyr-Leu-|-Tyr-Trp, in which cleavage of the -Tyr-|-Leu- and -Tyr-|-Trp bonds also occurs)

Target Background

Function

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Subcellular Location

Cytoplasm.

Protein Families

Peptidase S14 family

Database Links

KEGG: cbh:CLC_3142

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address