Recombinant Clostridium botulinum ATP-dependent Clp protease proteolytic subunit (clpP)

In Stock
Code CSB-EP401627CWV
Abbreviation Recombinant Clostridium botulinum clpP protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
clpP
Uniprot No.
Research Area
Microbiology
Alternative Names
clpP; CBO3231; CLC_3142ATP-dependent Clp protease proteolytic subunit; EC 3.4.21.92; Endopeptidase Clp
Species
Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
Source
E.coli
Expression Region
1-194aa
Target Protein Sequence
MSLVPVVVEQTNRGERSYDIYSRLLKDRIIMLSEEVNDTTASLIVAQLLFLEAEDPDKDIHLYINSPGGSITSGMAIYDTMQYIKPDVSTICVGMAASMGAFLLAAGAKGKRYALPNSEVMIHQPLGGFRGQATDIGIHAERILKMKKKLNTILSDRTGKPLEQVELDTERDHFLSAEEAKEYGLIDEVIDKKK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
37.5kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Enhance your microbiology research with our Recombinant Clostridium botulinum ATP-dependent Clp Protease Proteolytic Subunit, a crucial component of the Clp protease system involved in protein quality control and stress response in this pathogenic bacterium. Sourced from Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A), this recombinant protein is produced in E. coli for consistent quality and performance in your research applications.

Our Recombinant Clostridium botulinum ClpP protein provides the full length of the proteolytic subunit, with an expression region of 1-194aa, ensuring comprehensive functionality for your studies. The N-terminal 6xHis-SUMO-tag facilitates seamless purification and detection while preserving the protein's biological activity. With greater than 90% purity as determined by SDS-PAGE, our Recombinant Clostridium botulinum ClpP protein guarantees exceptional quality for your experiments.

Available as a lyophilized powder for convenient storage and reconstitution, the Recombinant Clostridium botulinum ATP-dependent Clp Protease Proteolytic Subunit is an outstanding choice for researchers exploring the intricate processes of protein degradation and stress response in this notorious bacterium. Trust our high-quality ClpP protein to elevate your research in the field of microbiology.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

I am writing to you regarding the product #CSB-EP401627CWV Recombinant Clostridium botulinum ATP-dependent Clp protease proteolytic subunit (clpP).
Could you, please, let me know whether the activity of the protein has been tested and with what substrate/assay? And does it require cofactors and accessory proteins to be present?
I intend to assess it on a small peptide but from my prior information it should not require these in the assay.

A:
Thanks for your inquiry.
Recombinant Clostridium botulinum ATP-dependent Clp protease proteolytic subunit(clpP)
CSB-YP401627CWV >> Yeast
CSB-EP401627CWV >> E.coli
CSB-BP401627CWV >> Baculovirus
CSB-MP401627CWV >> Mammalian cell
Expression region: 1-194aa; Full length;
Tag information: EP: N-terminal 6xHis-SUMO-tagged; BP&MP:N-terminal 10xHis-tagged and C-terminal Myc-tagged;YP:N-terminal 6xHis-tagged
Sequence:

MSLVPVVVEQTNRGERSYDIYSRLLKDRIIMLSEEVNDTTASLIVAQLLFLEAEDPDKDIHLYINSPGGSITSGMAIYDTMQYIKPDVSTICVGMAASMGAFLLAAGAKGKRYALPNSEVMIHQPLGGFRGQATDIGIHAERILKMKKKLNTILSDRTGKPLEQVELDTERDHFLSAEEAKEYGLIDEVIDKKK


We haven't tested the activity of this protein, so cannot 100% guaranteed. What we provide is the full length of mature protein, and it is purified under mild condition. It should be active in theory.
Here is a reference link:
https://www.uniprot.org/uniprot/A5I6W1
Hydrolysis of proteins to small peptides in the presence of ATP and magnesium. Alpha-casein is the usual test substrate. In the absence of ATP, only oligopeptides shorter than five residues are hydrolyzed (such as succinyl-Leu-Tyr-|-NHMec; and Leu-Tyr-Leu-|-Tyr-Trp, in which cleavage of the -Tyr-|-Leu- and -Tyr-|-Trp bonds also occurs)

Target Background

Function
Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.
Subcellular Location
Cytoplasm.
Protein Families
Peptidase S14 family
Database Links

KEGG: cbh:CLC_3142

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*