| Code | CSB-EP401627CWV |
| Abbreviation | Recombinant Clostridium botulinum clpP protein |
| MSDS | |
| Size | US$388 |
| Order now | |
| Image | |
| Have Questions? | Leave a Message or Start an on-line Chat |
Enhance your microbiology research with our Recombinant Clostridium botulinum ATP-dependent Clp Protease Proteolytic Subunit, a crucial component of the Clp protease system involved in protein quality control and stress response in this pathogenic bacterium. Sourced from Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A), this recombinant protein is produced in E. coli for consistent quality and performance in your research applications.
Our Recombinant Clostridium botulinum ClpP protein provides the full length of the proteolytic subunit, with an expression region of 1-194aa, ensuring comprehensive functionality for your studies. The N-terminal 6xHis-SUMO-tag facilitates seamless purification and detection while preserving the protein's biological activity. With greater than 90% purity as determined by SDS-PAGE, our Recombinant Clostridium botulinum ClpP protein guarantees exceptional quality for your experiments.
Available as a lyophilized powder for convenient storage and reconstitution, the Recombinant Clostridium botulinum ATP-dependent Clp Protease Proteolytic Subunit is an outstanding choice for researchers exploring the intricate processes of protein degradation and stress response in this notorious bacterium. Trust our high-quality ClpP protein to elevate your research in the field of microbiology.
There are currently no reviews for this product.
I am writing to you regarding the product #CSB-EP401627CWV Recombinant Clostridium botulinum ATP-dependent Clp protease proteolytic subunit (clpP).
Could you, please, let me know whether the activity of the protein has been tested and with what substrate/assay? And does it require cofactors and accessory proteins to be present?
I intend to assess it on a small peptide but from my prior information it should not require these in the assay.
MSLVPVVVEQTNRGERSYDIYSRLLKDRIIMLSEEVNDTTASLIVAQLLFLEAEDPDKDIHLYINSPGGSITSGMAIYDTMQYIKPDVSTICVGMAASMGAFLLAAGAKGKRYALPNSEVMIHQPLGGFRGQATDIGIHAERILKMKKKLNTILSDRTGKPLEQVELDTERDHFLSAEEAKEYGLIDEVIDKKK
KEGG: cbh:CLC_3142