Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-YP001933MOV |
| Product Type | Recombinant Protein |
| Size | US$2010 |
| Uniprot No. | P18659 |
| Relevance | Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma. Plays a multifaceted role in triglyceride homeostasis. Intracellularly, promotes hepatic very low density lipoprotein 1 (VLDL1) assembly and secretion; extracellularly, attenuates hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs). Impairs the lipolysis of TRLs by inhibiting lipoprotein lipase and the hepatic uptake of TRLs by remnant receptors. Formed of several curved helices connected via semiflexible hinges, so that it can wrap tightly around the curved micelle surface and easily adapt to the different diameters of its natural binding partners. |
| Image |
|
| Storage Buffer | Tris-based buffer,50% glycerol |
| Alias | Apolipoprotein C3 |
| Species | Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Sequence | SEAEDTSLLGFMQGYMQHATKTAKDALTSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKLSGFWDLNPEAKPTLAEAA |
| Source | Yeast |
| Gene Names | APOC3 |
| Protein Names | Recommended name: Apolipoprotein C-III Short name= Apo-CIII Short name= ApoC-IIIAlternative name(s): Apolipoprotein C3 |
| Expression Region | 21-99aa |
| Tag Info | N-terminal 6xHis-SUMOSTAR-tagged |
| Mol. Weight | 24.7kDa |
| Protein Description | Full Length of Mature Protein |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma. Plays a multifaceted role in triglyceride homeostasis. Intracellularly, promotes hepatic very low density lipoprotein 1 (VLDL1) assembly and secretion; extracellularly, attenuates hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs). Impairs the lipolysis of TRLs by inhibiting lipoprotein lipase and the hepatic uptake of TRLs by remnant receptors. Formed of several curved helices connected via semiflexible hinges, so that it can wrap tightly around the curved micelle surface and easily adapt to the different diameters of its natural binding partners. |
| Subcellular Location | Secreted |
| Protein Families | Apolipoprotein C3 family |
| Database Links |
KEGG: mcf:102144085 |
| Pathway |
PPAR signaling pathway
Cholesterol metabolism |
APOC3 Proteins for Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
| Code | Product Name | Source |
|---|---|---|
| CSB-BP001933MOV | Recombinant Macaca fascicularis Apolipoprotein C-III(APOC3) | Baculovirus |
| CSB-EP001933MOV CSB-MP001933MOV |
Recombinant Macaca fascicularis Apolipoprotein C-III(APOC3) | E.coli Mammalian cell |
Recombinant Rat Plasma kallikrein(Klkb1),Partial
Express system: E.coli
Species: Rattus norvegicus (Rat)
Recombinant Human Ornithine decarboxylase(ODC1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Protein disulfide-isomerase(P4HB)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Lymphocyte antigen 6 complex locus protein G6d(LY6G6D)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human rhinovirus A serotype 89 Genome polyprotein,partial
Express system: E.coli
Species: Human rhinovirus A serotype 89 (strain 41467-Gallo) (HRV-89)
