Recombinant Danio rerio Thyroid hormone receptor beta (thrb)

Code CSB-YP865519DIL
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP865519DIL
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP865519DIL-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP865519DIL
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP865519DIL
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
thrb; nr1a2; trb; si:ch211-264a6.2; Thyroid hormone receptor beta; TR-beta; TRb; Nuclear receptor subfamily 1 group A member 2; Thyroid hormone receptor beta-1; TRbeta1
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Expression Region
1-395
Target Protein Sequence
MSEQADKCNSRWKDEAMQNGYIPSYLDKDELCVVCGDKATGYHYRCITCEGCKGFFRRTI QKNLNPTYACKYEGKCVIDKVTRNQCQECRFKKCIAVGMATDLVLDDSKRLAKRKLIEEN RERRRREELQKTVWDRPEPTQEEWEMIRVVTEAHMATNAQGNHWKQKRKFLSAVGVKEAK PEDIGSAPIVNAPEGNKVDIEAFSQFTKIITPAITRVVDFAKKLPMFCELPCEDQIILLK GCCMEIMSLRAAVRYDPESDTLTLNGEMAVTRGQLKNGGLGVVSDAIFDLGVSLSSFNLD DSEVALLQAVILLSSDRPGLTSVERIERCQEEFLLAFEHYINYRKHKVAHFWPKLLMKVT DLRMIGACHASRFLHMKVECPTELFPPLFLEVFED
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Nuclear hormone receptor that can act as a repressor or activator of transcription. High affinity receptor for the thyroid gland hormone triiodothyronine (T3). Transactivating activity is ligand-dependent, and is repressed in the absence of T3.
Gene References into Functions
  1. Data provide evidence that zebrafish represents a valid model to study in vivo the thyroid hormone (TH) action, and the molecular mechanisms underlying the two syndromes of TH resistance, RTHa and RTHb. PMID: 26802880
  2. Loss- and gain-of-function experiments show that L-opsin expression requires trbeta2 activity before cone differentiation. Ectopic expression of trbeta2 after cone differentiation produces cones with mixed opsins. PMID: 23980162
  3. Data suggest that the embryonic to larval transitory phase is characterized by its dependency on the timely synthesis of thyroid hormone and the concomitant autoinductive increase in thyroid hormone receptor beta mRNA levels. PMID: 11963654
Subcellular Location
Nucleus.
Protein Families
Nuclear hormone receptor family, NR1 subfamily
Tissue Specificity
Widely expressed in a range of adult tissues including the brain, eye, fin, gill, intestine, liver, swim bladder and ovary. In the eye, expressed in the outer nuclear layer of the retina.
Database Links