Recombinant Dog Cholinesterase(BCHE)

Code CSB-EP002604DO
Product Type Recombinant Protein
Size US$2466
Uniprot No. P32750
Relevance Esterase with broad substrate specificity. Contributes to the inactivation of the neurotransmitter acetylcholine. Can degrade neurotoxic organophosphate esters .
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Acylcholine acylhydrolase;Butyrylcholine esterase;Choline esterase II;Pseudocholinesterase
Species Canis lupus familiaris (Dog) (Canis familiaris)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence NTDQSFPGFPGSEMWNPNTDLSEDCLYLNVWIPTPKPKNATVMIWIYGGGFQTGTSSLPVYDGKFLARVERVIVVSVNYRVGALGFLALPGNPEAPGNLGLFDQQLALQWVQKNIAAFGGNPKSVTLFGESAGAGSVGLHL
Research Area Others
Source E.coli
Gene Names BCHE
Expression Region 1-141aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 19.1kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Esterase with broad substrate specificity. Contributes to the inactivation of the neurotransmitter acetylcholine. Can degrade neurotoxic organophosphate esters (By similarity).
Subcellular Location Secreted
Protein Families Type-B carboxylesterase/lipase family
Tissue Specificity Present in most cells except erythrocytes.
Database Links

STRING: 9615.ENSCAFP00000021376

Related Products

BCHE Antibodies

BCHE Antibodies for Dog

BCHE Proteins

BCHE Proteins for Canis lupus familiaris (Dog) (Canis familiaris)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.