Recombinant Drosophila melanogaster Protein nanos (nos), partial

Code CSB-EP340723DLU1
Abbreviation Recombinant Drosophila melanogaster nos protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
nos
Uniprot No.
Research Area
Others
Species
Drosophila melanogaster (Fruit fly)
Source
E.coli
Expression Region
211-401aa
Target Protein Sequence
LGRNPAQLQTNGGNLMPIPLATHWLNNYREHLNNVWRNMSYIPAAPNTMGLQAQTAATVSTNLGVGMGLGLPVQGEQLRGASNSSNNNNNNNKVYKRYNSKAKEISRHCVFCENNNEPEAVINSHSVRDNFNRVLCPKLRTYVCPICGASGDSAHTIKYCPKKPIITMEDAIKAESFRLAKSSYYKQQMKV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
36.6
Protein Length
Partial
Tag Info
N-terminal 6xHis-KSI-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Maternal RNA-binding protein that is required for germ cells proliferation and self-renewal. Acts by forming a complex with pum and brat that regulates translation and mRNA stability. The complex binds to the Nanos Response Element (NRE), a 16 bp sequence in the hb mRNA 3'-UTR and prevents its translation. Controls posterior development. Rescuing factor for the abdominal defect of posterior group mutants. The other posterior group genes are not required for nanos function but rather play a role in localization or distribution of nanos protein.
Gene References into Functions
  1. Nos protein has dual functions in translational repression and stabilization of specific RNAs to ensure proper germline development. PMID: 29278271
  2. germ stem cell-rescuing activity of Wolbachia TomO protein appears to be tightly coupled to the ability to enhance Nos protein expression PMID: 29701280
  3. TomO enhances the maintenance of germ stem cells (GSCs) by elevating Nanos (Nos) expression via its interaction with nos mRNA, ultimately leading to the restoration of germ cell production in Sxl mutant females that are otherwise without GSCs.[ PMID: 27498563
  4. Translational repression of the Drosophila nanos mRNA involves the RNA helicase Belle and RNA coating by Me31B and Trailer hitch.Bel is required for nos mRNA translational repression. PMID: 28701521
  5. Results showed that nos mRNA, one of the target mRNAs of Hrp38 identified in this study, is regulated by Hrp38 for translational control during ovary development. PMID: 27402862
  6. The results of this experimentat showed that dynein motor machinery components mediate transport of nos mRNA in proximal dendrites. PMID: 24027279
  7. Mei-P26 associates with Bam, Bgcn and Sxl and nanos mRNA during early germline stem cell development, suggesting that this protein helps to repress the translation of nanos mRNA. PMID: 23526974
  8. nanos is a critical regulatory target of polar granule component in primordial germ cells. PMID: 23173091
  9. results suggest that Sxl enables the switch from germline stem cell to committed daughter cell by posttranscriptional down-regulation of nanos expression PMID: 22645327
  10. show that, during late oogenesis, nos translation is also repressed post-initiation and provide evidence that Glo mediates this event PMID: 21460235
  11. The minimal promoter (from -108 to +20) of Nanos is sufficient in the germline stem cells for the green fluorescent protein expression in transgenic Drosophila. PMID: 20026207
  12. Ectopic expression of the Translational Control Element of nos indicates that a common translational control mechanism functions in axial patterning and neuroendocrine signaling in Drosophila. PMID: 12091303
  13. removing Nanos from either germline stem cells (GSCs) or their precursors, PGCs, causes both cell types to differentiate into germline cysts; Nanos is essential for both establishing and maintaining GSCs by preventing their precocious entry into oogenesis PMID: 14976263
  14. Nos establishes germ-line/soma dichotomy and is also required to maintain germ-line fate. PMID: 15240884
  15. analysis of a translational control element in the nanos mRNA PMID: 15525666
  16. Nanos downregulates transcription and modulates CTD phosphorylation during Drosophila development PMID: 15817222
  17. The nanos translational control element represses translation in somatic cells by a Bearded box-like motif. PMID: 15936341
  18. Required to regulate the formation of the germ cell-specific spectrosome, further supporting a role for nos in promoting germ cell identity. PMID: 16028275
  19. Smaug response elements contained in the nanos 3'-untranslated region are necessary and sufficient to induce deadenylation PMID: 16793774
  20. Rumpelstiltskin regulates anterior-posterior axis patterning by functioning as a direct-acting nanos mRNA localization factor. PMID: 18234721
  21. Localization and translational control of nos mRNA are essential for dendritic arborization neuron morphogenesis. PMID: 18472422
  22. These observations suggest that Bam-Bgcn act together to antagonize Nos expression; thus, derepressing cystoblast-promoting factors; findings emphasize the importance of translational repression in balancing stem cell self-renewal and differentiation. PMID: 19470484

Show More

Hide All

Subcellular Location
Cytoplasm, Cytoplasmic ribonucleoprotein granule.
Protein Families
Nanos family
Tissue Specificity
Posterior part of the embryo. While the transcript is present throughout the embryo, nos translation is controlled by smg, and the protein is found in pole plasm and pole cells.
Database Links

KEGG: dme:Dmel_CG5637

STRING: 7227.FBpp0083146

UniGene: Dm.1485

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*