Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Target Names

nos

Uniprot No.

P25724

Research Area

Others

Species

Drosophila melanogaster (Fruit fly)

Source

E.coli

Expression Region

211-401aa

Target Protein Sequence

LGRNPAQLQTNGGNLMPIPLATHWLNNYREHLNNVWRNMSYIPAAPNTMGLQAQTAATVSTNLGVGMGLGLPVQGEQLRGASNSSNNNNNNNKVYKRYNSKAKEISRHCVFCENNNEPEAVINSHSVRDNFNRVLCPKLRTYVCPICGASGDSAHTIKYCPKKPIITMEDAIKAESFRLAKSSYYKQQMKV
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

36.6

Protein Length

Partial

Tag Info

N-terminal 6xHis-KSI-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Datasheet & COA

Please contact us to get it.

Target Background

Function

Maternal RNA-binding protein that is required for germ cells proliferation and self-renewal. Acts by forming a complex with pum and brat that regulates translation and mRNA stability. The complex binds to the Nanos Response Element (NRE), a 16 bp sequence in the hb mRNA 3'-UTR and prevents its translation. Controls posterior development. Rescuing factor for the abdominal defect of posterior group mutants. The other posterior group genes are not required for nanos function but rather play a role in localization or distribution of nanos protein.

Gene References into Functions

Nos protein has dual functions in translational repression and stabilization of specific RNAs to ensure proper germline development. PMID: 29278271
germ stem cell-rescuing activity of Wolbachia TomO protein appears to be tightly coupled to the ability to enhance Nos protein expression PMID: 29701280
TomO enhances the maintenance of germ stem cells (GSCs) by elevating Nanos (Nos) expression via its interaction with nos mRNA, ultimately leading to the restoration of germ cell production in Sxl mutant females that are otherwise without GSCs.[ PMID: 27498563
Translational repression of the Drosophila nanos mRNA involves the RNA helicase Belle and RNA coating by Me31B and Trailer hitch.Bel is required for nos mRNA translational repression. PMID: 28701521
Results showed that nos mRNA, one of the target mRNAs of Hrp38 identified in this study, is regulated by Hrp38 for translational control during ovary development. PMID: 27402862
The results of this experimentat showed that dynein motor machinery components mediate transport of nos mRNA in proximal dendrites. PMID: 24027279
Mei-P26 associates with Bam, Bgcn and Sxl and nanos mRNA during early germline stem cell development, suggesting that this protein helps to repress the translation of nanos mRNA. PMID: 23526974
nanos is a critical regulatory target of polar granule component in primordial germ cells. PMID: 23173091
results suggest that Sxl enables the switch from germline stem cell to committed daughter cell by posttranscriptional down-regulation of nanos expression PMID: 22645327
show that, during late oogenesis, nos translation is also repressed post-initiation and provide evidence that Glo mediates this event PMID: 21460235
The minimal promoter (from -108 to +20) of Nanos is sufficient in the germline stem cells for the green fluorescent protein expression in transgenic Drosophila. PMID: 20026207
Ectopic expression of the Translational Control Element of nos indicates that a common translational control mechanism functions in axial patterning and neuroendocrine signaling in Drosophila. PMID: 12091303
removing Nanos from either germline stem cells (GSCs) or their precursors, PGCs, causes both cell types to differentiate into germline cysts; Nanos is essential for both establishing and maintaining GSCs by preventing their precocious entry into oogenesis PMID: 14976263
Nos establishes germ-line/soma dichotomy and is also required to maintain germ-line fate. PMID: 15240884
analysis of a translational control element in the nanos mRNA PMID: 15525666
Nanos downregulates transcription and modulates CTD phosphorylation during Drosophila development PMID: 15817222
The nanos translational control element represses translation in somatic cells by a Bearded box-like motif. PMID: 15936341
Required to regulate the formation of the germ cell-specific spectrosome, further supporting a role for nos in promoting germ cell identity. PMID: 16028275
Smaug response elements contained in the nanos 3'-untranslated region are necessary and sufficient to induce deadenylation PMID: 16793774
Rumpelstiltskin regulates anterior-posterior axis patterning by functioning as a direct-acting nanos mRNA localization factor. PMID: 18234721
Localization and translational control of nos mRNA are essential for dendritic arborization neuron morphogenesis. PMID: 18472422
These observations suggest that Bam-Bgcn act together to antagonize Nos expression; thus, derepressing cystoblast-promoting factors; findings emphasize the importance of translational repression in balancing stem cell self-renewal and differentiation. PMID: 19470484

Hide All

Subcellular Location

Cytoplasm, Cytoplasmic ribonucleoprotein granule.

Protein Families

Nanos family

Tissue Specificity

Posterior part of the embryo. While the transcript is present throughout the embryo, nos translation is controlled by smg, and the protein is found in pole plasm and pole cells.

Database Links

KEGG: dme:Dmel_CG5637

STRING: 7227.FBpp0083146

UniGene: Dm.1485

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

CAPTCHA verification *

Code	CSB-EP340723DLU1
MSDS	MSDS
Size	$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Drosophila melanogaster Protein nanos (nos), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage