Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
ruvC; b1863; JW1852; Crossover junction endodeoxyribonuclease RuvC; EC 3.1.22.4; Holliday junction nuclease RuvC; Holliday junction resolvase RuvC
Species
Escherichia coli (strain K12)
Expression Region
2-173aa
Target Protein Sequence
AIILGIDPGSRVTGYGVIRQVGRQLSYLGSGCIRTKVDDLPSRLKLIYAGVTEIITQFQPDYFAIEQVFMAKNADSALKLGQARGVAIVAAVNQELPVFEYAARQVKQTVVGIGSAEKSQVQHMVRTLLKLPANPQADAADALAIAITHCHVSQNAMQMSESRLNLARGRLR
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant Escherichia coli (strain K12) ruvC was expressed with the amino acid range of 2-173. The theoretical molecular weight of the ruvC protein is 34.6 kDa. Expression of this ruvC protein is conducted in e.coli. Fusion of the N-terminal 6xHis-SUMO tag into the ruvC encoding gene fragment was conducted, allowing for easier detection and purification of the ruvC protein in subsequent stages.
The Escherichia coli crossover junction endodeoxyribonuclease RuvC is a key enzyme involved in the resolution of Holliday junctions during genetic recombination and DNA repair. As part of the RuvABC complex, RuvC works in coordination with RuvA and RuvB to process Holliday junctions formed during DNA recombination events. RuvC acts specifically at the junction point, symmetrically cleaving the DNA strands, leading to the separation and resolution of the crossover structure. This process is crucial for the accurate segregation of genetic material during cell division and the repair of DNA damage. RuvC's activity is tightly regulated and orchestrated within the RuvABC complex, highlighting its importance in maintaining genomic integrity in Escherichia coli. Understanding the molecular mechanisms of RuvC provides insights into the intricate processes of DNA repair and recombination, contributing to the broader knowledge of genome stability and maintenance.
