Recombinant Escherichia coli Crossover junction endodeoxyribonuclease RuvC (ruvC)

In Stock
Code CSB-EP364095ENV
Abbreviation Recombinant E.coli ruvC protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
ruvC
Uniprot No.
Research Area
Others
Alternative Names
ruvC; b1863; JW1852; Crossover junction endodeoxyribonuclease RuvC; EC 3.1.22.4; Holliday junction nuclease RuvC; Holliday junction resolvase RuvC
Species
Escherichia coli (strain K12)
Source
E.coli
Expression Region
2-173aa
Target Protein Sequence
AIILGIDPGSRVTGYGVIRQVGRQLSYLGSGCIRTKVDDLPSRLKLIYAGVTEIITQFQPDYFAIEQVFMAKNADSALKLGQARGVAIVAAVNQELPVFEYAARQVKQTVVGIGSAEKSQVQHMVRTLLKLPANPQADAADALAIAITHCHVSQNAMQMSESRLNLARGRLR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
34.6kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant Escherichia coli (strain K12) ruvC was expressed with the amino acid range of 2-173. The theoretical molecular weight of the ruvC protein is 34.6 kDa. Expression of this ruvC protein is conducted in e.coli. Fusion of the N-terminal 6xHis-SUMO tag into the ruvC encoding gene fragment was conducted, allowing for easier detection and purification of the ruvC protein in subsequent stages.

The Escherichia coli crossover junction endodeoxyribonuclease RuvC is a key enzyme involved in the resolution of Holliday junctions during genetic recombination and DNA repair. As part of the RuvABC complex, RuvC works in coordination with RuvA and RuvB to process Holliday junctions formed during DNA recombination events. RuvC acts specifically at the junction point, symmetrically cleaving the DNA strands, leading to the separation and resolution of the crossover structure. This process is crucial for the accurate segregation of genetic material during cell division and the repair of DNA damage. RuvC's activity is tightly regulated and orchestrated within the RuvABC complex, highlighting its importance in maintaining genomic integrity in Escherichia coli. Understanding the molecular mechanisms of RuvC provides insights into the intricate processes of DNA repair and recombination, contributing to the broader knowledge of genome stability and maintenance.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Nuclease that resolves Holliday junction intermediates in genetic recombination. Cleaves the cruciform structure in supercoiled DNA by nicking to strands with the same polarity at sites symmetrically opposed at the junction in the homologous arms and leaves a 5'-terminal phosphate and a 3'-terminal hydroxyl group.
Subcellular Location
Cytoplasm. Note=In 15% of cell localizes to discrete nucleoid foci (probable DNA damage sites) upon treatment with mitomycin C (MMC) for 2 hours.
Protein Families
RuvC family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*