Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
ruvB; b1860; JW1849; Holliday junction ATP-dependent DNA helicase RuvB; EC 3.6.4.12
Species
Escherichia coli (strain K12)
Expression Region
1-336aa
Target Protein Sequence
MIEADRLISAGTTLPEDVADRAIRPKLLEEYVGQPQVRSQMEIFIKAAKLRGDALDHLLIFGPPGLGKTTLANIVANEMGVNLRTTSGPVLEKAGDLAAMLTNLEPHDVLFIDEIHRLSPVVEEVLYPAMEDYQLDIMIGEGPAARSIKIDLPPFTLIGATTRAGSLTSPLRDRFGIVQRLEFYQVPDLQYIVSRSARFMGLEMSDDGALEVARRARGTPRIANRLLRRVRDFAEVKHDGTISADIAAQALDMLNVDAEGFDYMDRKLLLAVIDKFFGGPVGLDNLAAAIGEERETIEDVLEPYLIQQGFLQRTPRGRMATTRAWNHFGITPPEMP
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 1-336 form the expressed segment for recombinant Escherichia coli (strain K12) ruvB. This ruvB protein is expected to have a theoretical molecular weight of 53.2 kDa. This ruvB recombinant protein is manufactured in e.coli. The N-terminal 6xHis-SUMO tag was smoothly integrated into the coding gene of ruvB, which enables a simple process of detecting and purifying the ruvB recombinant protein in the following steps.
The Holliday junction ATP-dependent DNA helicase RuvB in Escherichia coli is a crucial component of the RuvABC complex involved in DNA repair and recombination processes. RuvB functions as a hexameric ring-shaped helicase and is responsible for branch migration during the resolution of Holliday junctions, which are DNA structures formed during genetic recombination. By utilizing ATP hydrolysis, RuvB translocates along the DNA strands, promoting the movement of the Holliday junction and facilitating its resolution. The resolution of Holliday junctions is vital for the accurate segregation of genetic material during cell division and the repair of DNA damage. RuvB's activity is tightly regulated and coordinated with other components of the RuvABC complex. Understanding the molecular mechanisms of RuvB provides insights into the intricate processes of DNA repair and recombination in bacteria, contributing to our broader understanding of genome maintenance and stability.
