Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

ruvB

Uniprot No.

P0A812

Research Area

Others

Alternative Names

ruvB; b1860; JW1849; Holliday junction ATP-dependent DNA helicase RuvB; EC 3.6.4.12

Species

Escherichia coli (strain K12)

Source

E.coli

Expression Region

1-336aa

Target Protein Sequence

MIEADRLISAGTTLPEDVADRAIRPKLLEEYVGQPQVRSQMEIFIKAAKLRGDALDHLLIFGPPGLGKTTLANIVANEMGVNLRTTSGPVLEKAGDLAAMLTNLEPHDVLFIDEIHRLSPVVEEVLYPAMEDYQLDIMIGEGPAARSIKIDLPPFTLIGATTRAGSLTSPLRDRFGIVQRLEFYQVPDLQYIVSRSARFMGLEMSDDGALEVARRARGTPRIANRLLRRVRDFAEVKHDGTISADIAAQALDMLNVDAEGFDYMDRKLLLAVIDKFFGGPVGLDNLAAAIGEERETIEDVLEPYLIQQGFLQRTPRGRMATTRAWNHFGITPPEMP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

53.2kDa

Protein Length

Full Length

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Amino acids 1-336 form the expressed segment for recombinant Escherichia coli (strain K12) ruvB. This ruvB protein is expected to have a theoretical molecular weight of 53.2 kDa. This ruvB recombinant protein is manufactured in e.coli. The N-terminal 6xHis-SUMO tag was smoothly integrated into the coding gene of ruvB, which enables a simple process of detecting and purifying the ruvB recombinant protein in the following steps.

The Holliday junction ATP-dependent DNA helicase RuvB in Escherichia coli is a crucial component of the RuvABC complex involved in DNA repair and recombination processes. RuvB functions as a hexameric ring-shaped helicase and is responsible for branch migration during the resolution of Holliday junctions, which are DNA structures formed during genetic recombination. By utilizing ATP hydrolysis, RuvB translocates along the DNA strands, promoting the movement of the Holliday junction and facilitating its resolution. The resolution of Holliday junctions is vital for the accurate segregation of genetic material during cell division and the repair of DNA damage. RuvB's activity is tightly regulated and coordinated with other components of the RuvABC complex. Understanding the molecular mechanisms of RuvB provides insights into the intricate processes of DNA repair and recombination in bacteria, contributing to our broader understanding of genome maintenance and stability.

Target Background

Function

The RuvA-RuvB complex in the presence of ATP renatures cruciform structure in supercoiled DNA with palindromic sequence, indicating that it may promote strand exchange reactions in homologous recombination. RuvAB is a helicase that mediates the Holliday junction migration by localized denaturation and reannealing.

Subcellular Location

Cytoplasm. Note=In 15% of cell localizes to discrete nucleoid foci (probable DNA damage sites) upon treatment with mitomycin C (MMC) for 2 hours.

Protein Families

RuvB family

Database Links

KEGG: ecj:JW1849

STRING: 316385.ECDH10B_2001

Code	CSB-EP364094ENV
Abbreviation	Recombinant E.coli ruvB protein
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP364094ENV could indicate that this peptide derived from E.coli-expressed Escherichia coli (strain K12) ruvB. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP364094ENV could indicate that this peptide derived from E.coli-expressed Escherichia coli (strain K12) ruvB.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Escherichia coli Holliday junction ATP-dependent DNA helicase RuvB (ruvB)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage