Recombinant Escherichia coli Holliday junction ATP-dependent DNA helicase RuvB(ruvB)

In Stock
Code CSB-EP364094ENV
Product Type Recombinant Protein
Size US$2466
Uniprot No. P0A812
Relevance The RuvA-RuvB complex in the presence of ATP renatures cruciform structure in supercoiled DNA with palindromic sequence, indicating that it may promote strand exchange reactions in homologous recombination. RuvAB is a helicase that mediates the Holliday junction migration by localized denaturation and reannealing.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP364094ENV could indicate that this peptide derived from E.coli-expressed Escherichia coli (strain K12) ruvB.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP364094ENV could indicate that this peptide derived from E.coli-expressed Escherichia coli (strain K12) ruvB.
Storage Buffer Tris-based buffer,50% glycerol
Species Escherichia coli (strain K12)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MIEADRLISAGTTLPEDVADRAIRPKLLEEYVGQPQVRSQMEIFIKAAKLRGDALDHLLIFGPPGLGKTTLANIVANEMGVNLRTTSGPVLEKAGDLAAMLTNLEPHDVLFIDEIHRLSPVVEEVLYPAMEDYQLDIMIGEGPAARSIKIDLPPFTLIGATTRAGSLTSPLRDRFGIVQRLEFYQVPDLQYIVSRSARFMGLEMSDDGALEVARRARGTPRIANRLLRRVRDFAEVKHDGTISADIAAQALDMLNVDAEGFDYMDRKLLLAVIDKFFGGPVGLDNLAAAIGEERETIEDVLEPYLIQQGFLQRTPRGRMATTRAWNHFGITPPEMP
Research Area Others
Source E.coli
Gene Names ruvB
Protein Names Recommended name: Holliday junction ATP-dependent DNA helicase RuvB EC= 3.6.4.12
Expression Region 1-336aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 53.2kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function The RuvA-RuvB complex in the presence of ATP renatures cruciform structure in supercoiled DNA with palindromic sequence, indicating that it may promote strand exchange reactions in homologous recombination. RuvAB is a helicase that mediates the Holliday junction migration by localized denaturation and reannealing.
Subcellular Location Cytoplasm
Protein Families RuvB family
Database Links

KEGG: ecj:JW1849

STRING: 316385.ECDH10B_2001

Related Products

ruvB Antibodies

ruvB Antibodies for Escherichia coli (strain K12)

ruvB Proteins

ruvB Proteins for Escherichia coli (strain K12)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.