Code | CSB-EP322992ENLe1 |
Abbreviation | Recombinant E.coli fanC protein |
MSDS | |
Size | US$554 |
Order now | |
Image |
|
Have Questions? | Leave a Message or Start an on-line Chat |
CUSABIO synthesized the recombinant gene by integrating the Tag-Free sequence into the targeted gene encoding the 23-181aa of the Escherichia coli fanC. The synthesized gene was subsequently cloned into an expression vector. After cloning, the expression vector was introduced into the E.coli for expression. The product was purified to obtain the recombinant Escherichia coli fanC protein carrying Tag-Free. The SDS-PAGE assayed the purity of this recombinant fanC protein greater than 90%. This fanC protein migrated along the gel to a band of about 17 kDa molecular weight.
fanC is a gene providing instruction of making a protein named K99 fimbrial protein in E.coli and belongs to fimbrial protein family. K99 fimbrial protein is the fimbrial type F5 and specifically mediates the attachment of Enterotoxigenic Escherichia coli (ETEC) to mucosal surfaces of calves, lambs, and piglets. ETEC colonize in the intestine by means of specific adhesion factors (fimbriae) and produce en terotoxins resulting in gastric diseases. Production of K99 requires the expression of eight unique proteins: FanA–H. FanC,the major subunit and immunogenic polypeptide of K99 fimbriae is the most highly expressed of the K99 genes.
There are currently no reviews for this product.
For protein: CSB-EP322992ENLe1 / RPC20557
However, I do have a question about the product. You say it comes in a buffer, but what does the buffer contains? I have looked for this protein with other suppliers as well and they all supply it lyophilized.
On your site it says expiry date: 12 months in lyophilized form; 6 months in solution form. This suggest it comes lyophilized?
Can you also provide me information about the suitability for MALDI-TOF MS? It is of high importance that I can use it for this technique because I want to determine the specific K99 peak.
NTGTINFNGKITSATCTIDPEVNGNRTSTIDLGQAAISGHGTVVDFKLKPAPGSNDCLAKTNARIDWSGSMNSLGFNNTASGNTAAKGYHMTLRATNVGNGSGGANINTSFTTAEYTHTSAIQSFNYSAQLKKDDRAPSNGGYKAGVFTTSASFLVTYM