Recombinant Escherichia coli Ribonuclease E (rne), partial

In Stock Promotion
Code CSB-EP324207ENV
Abbreviation Recombinant E.coli rne protein, partial
MSDS
Size $9.9
Promotion
CUSABIO Blowout: 4,100+ In-Stock Proteins
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
rne
Uniprot No.
Research Area
Others
Species
Escherichia coli (strain K12)
Source
E.coli
Expression Region
35-125aa
Target Protein Sequence
EQKKANIYKGKITRIEPSLEAAFVDYGAERHGFLPLKEIAREYFPANYSAHGRPNIKDVLREGQEVIVQIDKEERGNKGAALTTFISLAGS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
16.1 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Endoribonuclease that plays a central role in RNA processing and decay. Required for the maturation of 5S and 16S rRNAs and the majority of tRNAs. Also involved in the degradation of most mRNAs. Can also process other RNA species, such as RNAI, a molecule that controls the replication of ColE1 plasmid, and the cell division inhibitor DicF-RNA. It initiates the decay of RNAs by cutting them internally near their 5'-end. It is able to remove poly(A) tails by an endonucleolytic process. Required to initiate rRNA degradation during both starvation and quality control; acts after RNase PH (rph) exonucleolytically digests the 3'-end of the 16S rRNA. Degradation of 16S rRNA leads to 23S rRNA degradation. Processes the 3 tRNA(Pro) precursors immediately after the 3'-CCA to generate the mature ends.; Prefers 5'-monophosphorylated substrates over 5'-triphosphorylated substrates. 5'-monophosphate-assisted cleavage requires at least 2 and preferably 3 or more unpaired 5'-terminal nucleotides. The optimal spacing between the 5' end and the scissile phosphate appears to be 8 nucleotides. Any sequence of unpaired nucleotides at the 5'-end is tolerated.
Gene References into Functions
  1. This study suggests that, rather than its role in the processing of any one particular substrate, its distributed functions on all the different substrates (mRNA, rRNA, and tRNA) are responsible for the essentiality of RNase E in E. coli. PMID: 28167522
  2. Small RNAs processing and Hfq binding determinants for RNase E: RNase E cleaves any RNA fused to the 3' end. PMID: 26531825
  3. bacteria producing RNase E, have nutritional requirements different from those of cells supplied with only the N-terminal catalytic region of RNase E and mitigation of RNase E deficiency by overexpression of RNase G, is also affected by carbon source. PMID: 23275245
  4. Electrostatic potentials of were found to be conserved, highly positive, and spread over a large surface area encompassing four putative membrane-binding regions identified in the "large" domain. PMID: 22509045
  5. Strains harbouring rne alleles that express variants of RNase E in which 5' sensing or direct entry are inactivated, are viable. PMID: 22074454
  6. Increased abundance of R-loops in the rho and nusG mutants contributes to rescue the lethality associated with loss of the two RNase E cleavage pathways. PMID: 22026368
  7. demonstrated that CsdA, whose expression is induced by cold shock, interacts physically and functionally with RNase E PMID: 15554978
  8. The RNase E tetramer has two nonequivalent subunit interfaces, one of which is mediated by a single, tetrathiol-zinc complex; one or both interfaces organize the active site, which is distinct from the primary site of RNA binding. PMID: 15779893
  9. Observed role of RNase E in sodB mRNA turnover. PMID: 15781494
  10. crystal structures of the catalytic domain of RNase E as trapped allosteric intermediates with RNA substrates PMID: 16237448
  11. RNase E is required for induction of the glutamate-dependent acid resistance system in a RpoS-independent manner PMID: 17213667
  12. RNaseE and the other constituents of the RNA degradosome are components of the bacterial cytoskeleton PMID: 17242352
  13. This paper demonstrated that RNase E, a key endonuclease responsible for mRNA degradation in E. coli, regulates cspE transcript stability, possibly through the assembly of a degradosome. PMID: 18177308
  14. RNaseE and RNA helicase B play central roles in the cytoskeletal organization of the RNA degradosome PMID: 18337249
  15. RraA and RraB have a conserved property to directly act on RNAse E-related enzymes and inhibit their ribonucleolytic activity. PMID: 18510556
  16. Study shows that the arginine-rich RNA binding domain (ARRBD) of RNase E is important for the initial endoribonucleolytic cleavage of RNAI but dispensable for the endoribonucleolytic cleavages of the Rep mRNA. PMID: 19426759

Show More

Hide All

Subcellular Location
Cytoplasm. Cell inner membrane; Peripheral membrane protein; Cytoplasmic side.
Protein Families
RNase E/G family, RNase E subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*