Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

frr

Uniprot No.

P0A805

Research Area

Others

Alternative Names

Ribosome-releasing factor

Species

Escherichia coli (strain K12)

Source

E.coli

Expression Region

1-185aa

Target Protein Sequence

MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVFDRSMSPAVEKAIMASDLGLNPNSAGSDIRVPLPPLTEERRKDLTKIVRGEAEQARVAVRNVRRDANDKVKALLKDKEISEDDDRRSQDDVQKLTDAAIKKIEAALADKEAELMQF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

27.6 kDa

Protein Length

Full Length

Tag Info

C-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.133.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Datasheet & COA

Please contact us to get it.

Target Background

Function

Responsible for the release of ribosomes from messenger RNA at the termination of protein biosynthesis. May increase the efficiency of translation by recycling ribosomes from one round of translation to another.

Gene References into Functions

Ribosome recycling after peptide chain termination is a special case of the general RRF and EF-G function, which happens whenever fMet-tRNA is not available for triggering 70S scanning. PMID: 27261258
Data show that monosomes produced in ribosome recycling factor-deficient cells are able to translate synthetic homopolymer but not natural mRNA with leader and canonical initiation signal. PMID: 15522083
data enable a model to be proposed for the dual action of EF-G and RRF during ribosome recycling PMID: 15616575
domain II of RRF plays a crucial role in the concerted action of RRF and EF-G for the post-termination complex disassembly, and the specific interaction between RRF and EF-G on ribosomes mainly depends on the interaction between domain II of RRF and EF-G PMID: 16262604
V117D mutation does not perturb the efficient interdomain interaction, which results in cooperative unfolding of the RRF protein. PMID: 16684502
RRF is capable of spontaneously moving from its initial binding site on the 70S ribosome to a site exclusively on the large 50S ribosomal subunit. PMID: 17643374
The disruption of bridge B2a upon RRF binding to the ribosome seen in the present structures reveals one of the key roles that RRF plays in ribosome recycling, the dissociation of 70S ribosomes into subunits. PMID: 18234219

Hide All

Subcellular Location

Cytoplasm.

Protein Families

RRF family

Database Links

KEGG: ecj:JW0167

STRING: 316385.ECDH10B_0152

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-EP014941ENV
Abbreviation	Recombinant E.coli frr protein
MSDS	MSDS Datasheet
Size	$256
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Escherichia coli Ribosome-recycling factor (frr)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage