Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Microbiology
Alternative Names
eaeA; eae; Intimin; Attaching and effacing protein; Outer membrane protein; Fragment
Expression Region
1-280aa
Target Protein Sequence
ITEIKADKTTAVANGKDAVTYTVKVMKDGKPLSGEEVTFTTTLGTLSKSTEKTNTNGYRKVSLTSANQGKSLVSASVTMPQLMLKLLEVEFFTQLTIDNGNVEIVGTGAKGKLPNVWLQYGQVNLKANGGNGKYTWYSANPAIASVDPSSGQVTLKDKGETTITVVSGDKQTAIYTIAMPNSIVSVNSSGRVDYNTANNICKNIKGSLPSSIKELKDLYDDWGAANKYQHYSQESITAWTLQTSENKVQGVASTYDLVRKNPLIDKVDIAGNYAYAVCVK
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The region for expressing recombinant Hafnia alvei eaeA contains amino acids 1-280. The expected molecular weight for the eaeA protein is calculated to be 46.1 kDa. This protein is generated in a e.coli-based system. The N-terminal 6xHis-SUMO tag was smoothly integrated into the coding gene of eaeA, which enables a simple process of detecting and purifying the eaeA recombinant protein in the following steps.
The Hafnia alvei intimin, encoded by the eaeA gene, is a virulence factor that mediates the intimate adherence of the bacterium to the host cells, leading to localized alterations in the host cell cytoskeleton and the formation of characteristic attaching and effacing lesions. Intimin is often associated with gastrointestinal infections and is implicated in the pathogenesis of diseases such as diarrhea. Understanding the role of the Hafnia alvei intimin is important for studying the pathogenic mechanisms of this bacterium and for developing strategies to prevent and treat infections associated with Hafnia alvei.