Home
Protein
Recombinant Proteins
Recombinant Helicobacter pylori Glutamate--tRNA ligase 1 (gltX1)

Recombinant Helicobacter pylori Glutamate--tRNA ligase 1 (gltX1)

^{In Stock}

Code	CSB-YP308728HUV
Abbreviation	Recombinant Helicobacter pylori gltX1 protein
MSDS	MSDS Datasheet
Size	$436
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

gltX1

Uniprot No.

P96551

Research Area

Others

Alternative Names

gltX1; HP_0476; Glutamate--tRNA ligase 1; EC 6.1.1.17; Glutamyl-tRNA synthetase 1; GluRS 1

Species

Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)

Source

Yeast

Expression Region

1-463aa

Target Protein Sequence

MSLIVTRFAPSPTGYLHIGGLRTAIFNYLFARANQGKFFLRIEDTDLSRNSIEAANAIIEAFKWVGLEYDGEILYQSKRFEIYKEYIQKLLDEDKAYYCYMSKEELDALREEQKARKETPRYDNRYRDFKGTPPKGIEPVVRIKVPQNEVIGFNDGVKGEVKVNTNELDDFIIARSDGTPTYNFVVTIDDALMGITDVIRGDDHLSNTPKQIVLYKALNFKIPNFFHVPMILNEEGQKLSKRHGATNVMDYQEMGYLKEALVNFLARLGWSYQDKEVFSMQELLELFDPKDLNSSPSCFSWHKLNWLNAHYLKNQSVQELLKLLKPFSFSDLSHLNPTQLDRLLDALKERSQTLKELALKIDEVLIAPVEYEEKVFKKLNQALVMPLLEKFKLELNKANFNDESALENAMRQIIEEEKIKAGSFMQPLRLALLGKGGGIGLKEALFILGKTESVKRIEDFLKN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

55.4kDa

Protein Length

Full Length

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

To achieve the expression of the recombinant Helicobacter pylori (strain ATCC 700392 / 26695) gltX1 protein in Yeast cells, a DNA fragment encoding the Helicobacter pylori (strain ATCC 700392 / 26695) gltX1 protein (1-463aa) is inserted into a plasmid vector, which is then transferred to Yeast cells. After screening positive cells, they are cultured and induced to generate the gltX1 protein. A N-terminal 6xHis tag is attached to the protein. Cells are lysed to collect the recombinant Helicobacter pylori (strain ATCC 700392 / 26695) gltX1 protein, which is purified through affinity purification and then identified using SDS-PAGE and subsequent staining of the gel with Coomassie Brilliant Blue. The purity of the obtained recombinant Helicobacter pylori (strain ATCC 700392 / 26695) gltX1 protein is over 90%.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Catalyzes the attachment of glutamate to tRNA(Glu) in a two-step reaction: glutamate is first activated by ATP to form Glu-AMP and then transferred to the acceptor end of tRNA(Glu).

Subcellular Location

Cytoplasm.

Protein Families

Class-I aminoacyl-tRNA synthetase family, Glutamate--tRNA ligase type 1 subfamily

Database Links

KEGG: heo:C694_02440

STRING: 85962.HP0476

Promotions