Recombinant Helicobacter pylori Glutamate--tRNA ligase 1(gltX1)

Code CSB-EP308728HUV
Product Type Recombinant Protein
Size US$2466
Uniprot No. P96551
Relevance Catalyzes the attachment of glutamate to tRNA(Glu) in a two-step reaction: glutamate is first activated by ATP to form Glu-AMP and then transferred to the acceptor end of tRNA(Glu).
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Glutamyl-tRNA synthetase 1
Species Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MSLIVTRFAPSPTGYLHIGGLRTAIFNYLFARANQGKFFLRIEDTDLSRNSIEAANAIIEAFKWVGLEYDGEILYQSKRFEIYKEYIQKLLDEDKAYYCYMSKEELDALREEQKARKETPRYDNRYRDFKGTPPKGIEPVVRIKVPQNEVIGFNDGVKGEVKVNTNELDDFIIARSDGTPTYNFVVTIDDALMGITDVIRGDDHLSNTPKQIVLYKALNFKIPNFFHVPMILNEEGQKLSKRHGATNVMDYQEMGYLKEALVNFLARLGWSYQDKEVFSMQELLELFDPKDLNSSPSCFSWHKLNWLNAHYLKNQSVQELLKLLKPFSFSDLSHLNPTQLDRLLDALKERSQTLKELALKIDEVLIAPVEYEEKVFKKLNQALVMPLLEKFKLELNKANFNDESALENAMRQIIEEEKIKAGSFMQPLRLALLGKGGGIGLKEALFILGKTESVKRIEDFLKN
Research Area Others
Source E.coli
Gene Names gltX1
Expression Region 1-463aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 69.4kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalyzes the attachment of glutamate to tRNA(Glu) in a two-step reaction
Subcellular Location Cytoplasm
Protein Families Class-I aminoacyl-tRNA synthetase family, Glutamate--tRNA ligase type 1 subfamily
Database Links

KEGG: heo:C694_02440

STRING: 85962.HP0476

Related Products

gltX1 Antibodies

gltX1 Antibodies for Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)

gltX1 Proteins

gltX1 Proteins for Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.