Recombinant Human HLA class II histocompatibility antigen,DQ beta 1 chain (HLA-DQB1), partial

In Stock
Code CSB-EP355782HU
Abbreviation Recombinant Human HLA-DQB1 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
CELIAC1; DQ beta 1 chain; DQB1_HUMAN; HLA class II histocompatibility antigen; HLA class II histocompatibility antigen; DQ beta 1 chain; HLA class II histocompatibility antigen; DQ beta 2 chain; HLA DQB; HLA DQB1; HLA-DQB1; HLA-DQB2; IDDM1; Lymphocyte antigen; Major histocompatibility complex class II beta; Major histocompatibility complex; class II; DQ beta 1; MHC class II antigen DQB1; MHC class II antigen HLA DQ beta 1; MHC class II DQ beta chain; MHC class II HLA DQ beta glycoprotein; MHC class2 antigen; MHC DQ beta; OTTHUMP00000029167; OTTHUMP00000178569; OTTHUMP00000178570; OTTHUMP00000178571
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
33-227aa
Target Protein Sequence
RDSPEDFVYQFKAMCYFTNGTERVRYVTRYIYNREEYARFDSDVEVYRAVTPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQHGDVYTCHVEHPSLQNPITVEWRAQSESA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
27.0 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The region for expressing recombinant Human HLA-DQB1 contains amino acids 33-227. The calculated molecular weight for this HLA-DQB1 protein is 27 kDa. This HLA-DQB1 recombinant protein is manufactured in e.coli. The N-terminal 6xHis tag was smoothly integrated into the coding gene of HLA-DQB1, which enables a simple process of detecting and purifying the HLA-DQB1 recombinant protein in the following steps.

The human HLA class II histocompatibility antigen, DQ beta 1 chain (HLA-DQB1), is a crucial component of the major histocompatibility complex (MHC) class II molecules, which play a pivotal role in the immune system. HLA-DQB1 is highly polymorphic, with multiple alleles contributing to individual variability in immune responses. It is primarily expressed on the surface of antigen-presenting cells, such as macrophages, dendritic cells, and B cells. HLA-DQB1 is involved in presenting peptide antigens to CD4+ T lymphocytes, initiating the adaptive immune response. This process is essential for immune surveillance, as it allows the immune system to distinguish between self and non-self antigens. The polymorphic nature of HLA-DQB1 is crucial for its ability to present a wide array of antigens, enabling the immune system to recognize and respond to diverse pathogens.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

We are trying to develop a multiplexing assay on Luminex to detect the HLA Class I and II antibodies in individuals.
We are looking for manufacturer who can provide us human derived recombined HLA class I and II antigens, checked on your website
and find some Locus antigens are available with you. For the panel designing we need antigens of locu DQB1.
Could you please provide some idea about it?

A:
As to your request for the antigen of DQB1, please check detailed information as follows:
We can provide all of these antigens expressed by our four expression systems: E.coli, Yeast, Baculovirus and Mammalian Cell, please check and confirm which expression system you need.
DQB1
Recombinant Human HLA class II histocompatibility antigen, DQ beta 1 chain(HLA-DQB1),partial
CSB-YP355782HU >> Yeast
CSB-EP355782HU >> E.coli
CSB-BP355782HU >> Baculovirus
CSB-MP355782HU >> Mammalian cell
Expression Region:33-230aa; Partial, provide the complete extracellular domain.
Tag information:Tag type will be determined during the manufacturing process.
The expected tag for each expression system is listed as follows: YP: N-terminal 6xHis-tagged; EP, BP, MP: N-terminal 10xHis-tagged and C-terminal Myc-tagged.
Sequence:

RDSPEDFVYQFKAMCYFTNGTERVRYVTRYIYNREEYARFDSDVEVYRAVTPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQHGDVYTCHVEHPSLQNPITVEWRAQSESAQSK


Reference:http://www.uniprot.org/uniprot/P01920
In addition, we have another partial protein to recommend, the lead time is relatively short.
Recombinant Human MHC class II antigen(HLA-DQB1),partial
CSB-RP148494h >> E.coli
Expression Region:33-227aa; Partial.
Tag information:N-terminal 6xHis-tagged
Sequence:

RDSPEDFVFQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVTPQGRPDAEYWNSQKEVLEGTRAELDTVCRHNYEVAFRGILQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPGQIKVRWFRNDQEETAGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQSPITVEWRAQSESA


Reference:http://www.uniprot.org/uniprot/Q5Y7D0

Target Background

Function
Binds peptides derived from antigens that access the endocytic route of antigen presenting cells (APC) and presents them on the cell surface for recognition by the CD4 T-cells. The peptide binding cleft accommodates peptides of 10-30 residues. The peptides presented by MHC class II molecules are generated mostly by degradation of proteins that access the endocytic route, where they are processed by lysosomal proteases and other hydrolases. Exogenous antigens that have been endocytosed by the APC are thus readily available for presentation via MHC II molecules, and for this reason this antigen presentation pathway is usually referred to as exogenous. As membrane proteins on their way to degradation in lysosomes as part of their normal turn-over are also contained in the endosomal/lysosomal compartments, exogenous antigens must compete with those derived from endogenous components. Autophagy is also a source of endogenous peptides, autophagosomes constitutively fuse with MHC class II loading compartments. In addition to APCs, other cells of the gastrointestinal tract, such as epithelial cells, express MHC class II molecules and CD74 and act as APCs, which is an unusual trait of the GI tract. To produce a MHC class II molecule that presents an antigen, three MHC class II molecules (heterodimers of an alpha and a beta chain) associate with a CD74 trimer in the ER to form a heterononamer. Soon after the entry of this complex into the endosomal/lysosomal system where antigen processing occurs, CD74 undergoes a sequential degradation by various proteases, including CTSS and CTSL, leaving a small fragment termed CLIP (class-II-associated invariant chain peptide). The removal of CLIP is facilitated by HLA-DM via direct binding to the alpha-beta-CLIP complex so that CLIP is released. HLA-DM stabilizes MHC class II molecules until primary high affinity antigenic peptides are bound. The MHC II molecule bound to a peptide is then transported to the cell membrane surface. In B-cells, the interaction between HLA-DM and MHC class II molecules is regulated by HLA-DO. Primary dendritic cells (DCs) also to express HLA-DO. Lysosomal microenvironment has been implicated in the regulation of antigen loading into MHC II molecules, increased acidification produces increased proteolysis and efficient peptide loading.
Gene References into Functions
  1. This study showed for the first time that HLA-DQB1 genotypes is genetic markers associated with disability progression in Slovak MS patients. PMID: 29619906
  2. Studied association of HLADQB1*03 genotype and perioperative blood transfusion with regards to prognosis in surgically treated gastric cancer patients. PMID: 29667729
  3. heightened expression of HLA-DQB1 and -DQB2 in pre-implantation biopsies are promising tools for pre-transplant risk assessment of poor late graft function in transplants with kidneys from 18 to 49-year-old donors PMID: 29800590
  4. There was a significant association between HLA-DQB1*05 and (HLA-DRB1*14) and pemphigus vulgaris in Indian patients. PMID: 29582787
  5. In addition to the gene dosage effect confirmed in our report, and in contrast with previous studies, we found a raised risk for those patients with DQ2.2 heterodimers in trans configuration to DQ2.5 compared to DQ2.5 homozygous individuals. Therefore, in our population of patients with celiac disease (CD) the frequency of DQ2.2 acts as a factor that increases the genetic risk of developing CD. PMID: 29361871
  6. alleles DQB1*05:03 and DQB1*03:02 may be the susceptibility factors for pemphigus vulgaris;DQB1*05:01, DQB1*02, DQB1*06:01, and DQB1*03:03 are negatively associated with pemphigus vulgaris (Meta-Analysis) PMID: 29182409
  7. The significant differences in the frequency of HLA-DQ2 and HLA-DQ8 alleles in Syrian patients compared with controls demonstrated the importance role of these alleles in the development of CD and support the possibility of using HLA-DQ typing in confirmation of the disease. PMID: 29793442
  8. HLA-DRB1 and -DQB1 gene polymorphisms contribute to the development/protection of type 1 diabetes with/without autoimmune thyroiditis. PMID: 29958949
  9. This study suggests the involvement of rs6457617 locus as risk variant for susceptibility/severity to rheumatoid arthritis in Tunisian population. Secondly, it highlights the gene-gene interaction between HLA-DQB1 and HLA-DRB1. PMID: 29321349
  10. These data revealed that HLA-DQB1*06 had a protective effect on the course of HIV-1 and T-cell targeting of certain specific Nef epitopes, contributing to HIV-1 suppression. The results suggested the potential use of HLA-DQB1*06 and Nef core region in HIV-1 T-cell vaccine design. PMID: 28771107
  11. The patients with coexisting type 1 diabetes mellitus and celiac disease had an HLA-DRB1 and HLA-DQB1 profile that was more similar to diabetes patients than celiac disease patients. PMID: 28247576
  12. Bullous pemphigoid patients with the HLA-DQB1*03:01 allele show an increased T-cell avidity to several epitopes of BP180, particularly the BP180-NC16a domain. (Review) PMID: 28101965
  13. The presence of HLA-DQB1*0602 allele, but not HLA-DRB1*15 allele, was significantly associated with obstructive sleep apnea. PMID: 28875928
  14. these findings indicate that coronary artery disease in Southern Han Chinese is negatively associated with HLA-DQB1*03:01:01G and DQB1*05:03:01G PMID: 28624488
  15. in the Iranian population, HLA-DQB1*0201 appears to have protective role PMID: 28919585
  16. Our results implicated HLA-DQB1 in the development of ankylosing spondylitis PMID: 28743287
  17. HLA-DRB1/DQB1 gene variants appeared to modulate the alteration of the left posterior cingulate volume, hence modulating the susceptibility of Alzheimer's disease. PMID: 27056075
  18. HLA-DQ4 positive patients have a higher risk of Vogt-Koyanagi-Harada disease.Risk factor is HLA-DQB1*0401, while protective ones may include HLA-DQB1*0301, 0402, 0601, 0603. PMID: 29443768
  19. Longevity and lipid homeostasis were associated with HLA-DQB1 and suggest that immune gene variants could be involved in maintaining homeostasis and anti-aging in longevity. PMID: 29129831
  20. The results confirm the association of HLA-DRB1*04, specifically HLA-DRB1*04:05 subtype, and DRB1*04-DQB1*03 haplotype with rheumatoid arthritis susceptibility in Tunisians. PMID: 27580864
  21. The AG/GG genotype of rs9275572 and HLA-DQB1 Block2 CCCCC haplotype may have protective effects in hepatitis B virus-related hepatocellular carcinoma patients receiving hepatic resection. PMID: 27288300
  22. No association was found between HLA-DRB1 or -DQB1 alleles and 25OHD concentration PMID: 27623983
  23. the combination of rs6903608 and HLA-DQB1*05:03 may explain most of the HLA association signal in acquired thrombotic thrombocytopenic purpura PMID: 27762046
  24. This meta-analysis demonstrates that DQB1*02 and DQB1*06 may be negatively associated with RA. Conversely, DQB1*04 may confer susceptibility to RA. PMID: 28455285
  25. these results confirm an association of HLA-DQB1 alleles and haplotypes with polycystic ovary syndrome susceptibility in Bahraini PMID: 27505846
  26. HLA-DRB1*08:03:02 and HLA-DQB1*06:01:01 are associated with house dust mites (HMD)-sensitive AR and may confer a risk for development of allergic rhinitis in Han Chinese subjects sensitized to HDM. PMID: 27013183
  27. The DQB1*05:03 allele was associated with pemphigus vulgaris in our study as well as in various populations. PMID: 28197992
  28. the frequencies of HLA-DRB1*03:01 (pc = 0.0378, OR = 4.8) and HLA-DQB1*02:01 (pc = 0.021, OR = 4.8) alleles were significantly higher in patients with JORRP than in controls. In addition, HLA-DRB1*03:01 allele significantly correlated with aggressive JORRP PMID: 29106857
  29. association of DR4/DR8 heterozygous genotype suggested the pathologic importance of trans-complementing DQalpha-beta heterodimer molecules encoded by DQA1 allele of one haplotype and the DQB1 allele of the other haplotype, as it was proposed in the HLA association studies of Type 1 diabetes PMID: 29088299
  30. This study shows that clearance of HCV is associated with DQB1*03:01:01:01 allele and chronicity of HCV infection associated with the risk allele: DQB1*02:01:01. PMID: 27599887
  31. HLA-DQB1*06:02 does not seem to be associated with hypoxic ventilatory response or hypercapnic ventilatory response; however there are point wise, uncorrected significant associations between two TASK2/KCNK5 variants (rs2815118 and rs150380866) and hypercapnic ventilatory response PMID: 28045995
  32. we found that, among Caucasian patients treated with BoNT/A, DQB1*06:04 were higher in Ab-positive than in Ab-negative patients. The genetic linkage was on the threshold of corrected significance. PMID: 28385185
  33. HLA-DRB1*11, -DRB1*04 and -DQB1*03 allele frequencies between Black patients and healthy Black individuals revealed no significant difference in thrombotic thrombocytopenic purpura, but protective allele against TTP, HLA-DRB1*04, was dramatically decreased in Black individuals in comparison with White individuals PMID: 27383202
  34. HLA-DQbeta1 insertion confers achalasia risk in Polish and Swedish population. Frequency of the insertion shows a geospatial north-south gradient among Europeans. PMID: 26733285
  35. Amino-acid changes at position 66 and 67 confer susceptibility to age-related macular degeneration. PMID: 26733291
  36. Our study suggested no significant correlation between narcolepsy, MS and HLA-DQB1*06:02. The HLA-DQB1*06:02 allele alone was not sufficient to cause multiple sclerosis patients to develop narcolepsy. PMID: 28658402
  37. HLA-DRB1 and DQB1 genotyping reveals that X chromosome inactivation has a role in susceptibility to rheumatoid arthritis and systemic sclerosis PMID: 27355582
  38. Frequencies of DQB1*02:02 and DQB1*03:03 were not significantly different in juvenile-onset systemic sclerosis (SSc) versus controls. A marginally significant decrease in the frequency of DQB1*06 was observed in juvenile-onset SSc, mostly attributable to DQB1*06:02, which is in linkage disequilibrium with DRB1*15 PMID: 27214100
  39. DRB1*04 DQB1*02 and DRB1*07 DQB1*02 haplotypes were absent in cutaneous leishmaniasis patients. DRB1*15 DQB1*06 haplotype was over represented in controls. PMID: 27301744
  40. We demonstrated that allele HLA-DQB1*06 is associated with susceptibility to generalized vitiligo. PMID: 26769539
  41. Anti-LGI1 encephalitis was associated with the DQB1 haplotypes. PMID: 28026029
  42. In respect of HLA genes, factors are involved in the incidence of Recurrent aphthous stomatitis ; various HLA-DRB and HLA-DQB1 alleles and the related haplotypes are suggested to be the three main Recurrent aphthous stomatitis susceptibility factors in our population study. PMID: 27921409
  43. An eight-residue insertion in HLA-DQ[beta]1 was associated with idiopathic esophageal achalasia in a European sample. PMID: 26882171
  44. The present study identified an association of HLA-DQB1*03:01 with predisposition to, and DQB1*03:02 with resistance to, bronchiectatic airway disease or emphysema in RA. PMID: 27048628
  45. The results show that HLA-DQB1*05:02, HLA-DRB1*16:02 and HLA-B*67:01, in linkage disequilibrium with each other, are associated with susceptibility to RPC. PMID: 27241705
  46. The frequency of haplotype DRB1*090102-DQB1*060101 was significantly higher, whereas that of HLA-DRB1*070101-DQB1*020101 was significantly lower compared with healthy controls. The study indicated that HLA-DQB1*060101 alleles may be a potential predictor of high-risk IgAN susceptibility in Chinese Han population. PMID: 27896619
  47. DQB1 contributes to the genetic predisposition to narcolepsy type 1 (NT1), type 2 (NT2), idiopathic hypersomnia (IH) and no central hypersomnia subjects (no-CH) in Czech patients PMID: 28083611
  48. this study demonstrated that HLA class II allele DQB1*05:01 might contribute to clinical worsening in the cluster Guillain-Barre syndrome patients. PMID: 27485170
  49. HLA-DRB1*/DQB1* alleles and haplotypes strongly predispose South Indian population to ischaemic stroke PMID: 27105925
  50. this study shows association of HLA-DQB1 alleles with lupus nephritis in Moroccan population PMID: 27611588

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein. Endoplasmic reticulum membrane; Single-pass type I membrane protein. Golgi apparatus, trans-Golgi network membrane; Single-pass type I membrane protein. Endosome membrane; Single-pass type I membrane protein. Lysosome membrane; Single-pass type I membrane protein. Note=The MHC class II complex transits through a number of intracellular compartments in the endocytic pathway until it reaches the cell membrane for antigen presentation.
Protein Families
MHC class II family
Database Links

HGNC: 4944

OMIM: 604305

KEGG: hsa:3119

UniGene: Hs.409934

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*