Code | CSB-EP355782HU |
MSDS | |
Size | $224 |
Order now | |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
The region for expressing recombinant Human HLA-DQB1 contains amino acids 33-227. The calculated molecular weight for this HLA-DQB1 protein is 27 kDa. This HLA-DQB1 recombinant protein is manufactured in e.coli. The N-terminal 6xHis tag was smoothly integrated into the coding gene of HLA-DQB1, which enables a simple process of detecting and purifying the HLA-DQB1 recombinant protein in the following steps.
The human HLA class II histocompatibility antigen, DQ beta 1 chain (HLA-DQB1), is a crucial component of the major histocompatibility complex (MHC) class II molecules, which play a pivotal role in the immune system. HLA-DQB1 is highly polymorphic, with multiple alleles contributing to individual variability in immune responses. It is primarily expressed on the surface of antigen-presenting cells, such as macrophages, dendritic cells, and B cells. HLA-DQB1 is involved in presenting peptide antigens to CD4+ T lymphocytes, initiating the adaptive immune response. This process is essential for immune surveillance, as it allows the immune system to distinguish between self and non-self antigens. The polymorphic nature of HLA-DQB1 is crucial for its ability to present a wide array of antigens, enabling the immune system to recognize and respond to diverse pathogens.There are currently no reviews for this product.
We are trying to develop a multiplexing assay on Luminex to detect the HLA Class I and II antibodies in individuals.
We are looking for manufacturer who can provide us human derived recombined HLA class I and II antigens, checked on your website
and find some Locus antigens are available with you. For the panel designing we need antigens of locu DQB1.
Could you please provide some idea about it?
RDSPEDFVYQFKAMCYFTNGTERVRYVTRYIYNREEYARFDSDVEVYRAVTPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQHGDVYTCHVEHPSLQNPITVEWRAQSESAQSK
RDSPEDFVFQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVTPQGRPDAEYWNSQKEVLEGTRAELDTVCRHNYEVAFRGILQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPGQIKVRWFRNDQEETAGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQSPITVEWRAQSESA