Recombinant Human 2'-5'-oligoadenylate synthase 1 (OAS1)

Code CSB-YP640913HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP640913HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP640913HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
2'-5'-oligoadenylate synthase 1; (2-5'oligo(A; synthase 1; 2-5A synthase 1; EC 2.7.7.84; E18/E16; p46/p42 OAS; OAS1 OIAS
Species
Homo sapiens (Human)
Expression Region
1-400
Target Protein Sequence
MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGGYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLAESNSADDETDDPRRYQKYGYIGTHEYPHFSHRPSTLQAASTPQAEEDWTCTIL
Protein Length
Full Length
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Interferon-induced, dsRNA-activated antiviral enzyme which plays a critical role in cellular innate antiviral response. In addition, it may also play a role in other cellular processes such as apoptosis, cell growth, differentiation and gene regulation. Synthesizes higher oligomers of 2'-5'-oligoadenylates (2-5A) from ATP which then bind to the inactive monomeric form of ribonuclease L (RNase L) leading to its dimerization and subsequent activation. Activation of RNase L leads to degradation of cellular as well as viral RNA, resulting in the inhibition of protein synthesis, thus terminating viral replication. Can mediate the antiviral effect via the classical RNase L-dependent pathway or an alternative antiviral pathway independent of RNase L. The secreted form displays antiviral effect against vesicular stomatitis virus (VSV), herpes simplex virus type 2 (HSV-2), and encephalomyocarditis virus (EMCV) and stimulates the alternative antiviral pathway independent of RNase L.
Gene References into Functions
  1. two additional de novo heterozygous missense variations of OAS1 in two unrelated simplex individuals also manifesting infantile-onset Pulmonary alveolar proteinosis with hypogammaglobulinemia. PMID: 29455859
  2. OAS1 rs2057778) genotype was significantly related to severe necroinflammatory activity (NIA) grade of chronic hepatitis C patients. PMID: 28704535
  3. Our results establish OAS1 as a risk locus for Sjogren's syndrome and support a potential role for defective viral clearance due to altered IFN response as a genetic pathophysiological basis of this complex autoimmune disease PMID: 28640813
  4. we characterized the functional consequences of the Neandertal haplotype in the transcriptional regulation of OAS genes at baseline and infected conditions. We found that cells from people with the Neandertal-like haplotype express lower levels of OAS3 upon infection, as well as distinct isoforms of OAS1 and OAS2 PMID: 27899133
  5. In insulitic islets from living patients with recent-onset T1D, most of the overexpressed ISGs, including GBP1, TLR3, OAS1, EIF2AK2, HLA-E, IFI6, and STAT1, showed higher expression in the islet core compared with the peri-islet area containing the surrounding immune cells PMID: 27422384
  6. ELF-1 binds an important duplicated GGAA cis-acting element at the OAS1 promoter and in cooperation with RB1 and SP1 recruitment contributes to regulation in response to IFN stimulation. PMID: 26643049
  7. Knockdown of OAS1 rescues Lipopolysaccharide-induced cell death and thus may be a promising therapeutic strategy for orthopedic diseases. PMID: 26516113
  8. The multivariate analysis showed that the OAS1 GA and AA genotypes were independent factors associated with liver fibrosis progression (p = 0.009, odds ratio [OR] 3.467, 95% confidence interval [CI] 1.273-7.584). PMID: 26505957
  9. Preliminary study suggests that OAS gene cluster and CD209 gene polymorphisms influence the risk of developing clinical symptoms in Chikungunya virus-infected patients. PMID: 26398832
  10. While both OAS1-p42 and p46 showed antiviral activity against Dengue irus 2, only OAS1-p42 presented anti-Dengue irus 1 activity. PMID: 26063222
  11. No association is identified between OAS1 SNP and susceptibility to spontaneous preterm birth (SPTB) and preterm premature rupture of membranes (PPROM). PMID: 26412166
  12. along with TLR3, functions as a virus recognition receptor on mast cells activating the latent form of RNase L, leading to viral RNA degradation PMID: 25550087
  13. our research shows that the OAS1 rs10774671 SNP is associated with CA16 susceptibility and is correlated with mild and severe HFMD. PMID: 25059424
  14. The IFNs inhibit viral infections in part through the 2',5'-oligoadenylate (2-5A) synthetase (OAS)/RNase L pathway. PMID: 24905202
  15. The findings represent discovery of a novel signature for OAS1 activation, the 3'-single-stranded pyrimidine (3'-ssPy) motif, with potential functional implications for OAS1 activity in its antiviral and other anti-proliferative roles. PMID: 25477390
  16. The OAS1 p46 isoform localizes to the mitochondria. PMID: 25205466
  17. These results identify OAS1 single nucleotide polymorphism rs2660, rs10774671, and rs3741981 as genetic risk factors for chronic hepatitis C. PMID: 22710942
  18. Findings provide insights into the potential role of OAS1 polymorphisms in respiratory infection. PMID: 23220500
  19. The results suggest that OAS1-OAS3-OAS2 haplotypes are associated with differential susceptibility to clinical outcomes of dengue infection. PMID: 23337612
  20. Data show that oligoadenylate synthetase 1 (hOAS1) undergoes more than 20,000-fold activation upon double-stranded RNA (dsRNA) binding. PMID: 23319625
  21. among the members of the OAS family, OAS1 p46 and OAS3 p100 mediate the RNase L-dependent antiviral activity against HCV PMID: 23196181
  22. Data show that transfection of ORMDL3 in bronchial epithelial cells induced expression of MMP-9, ADAM-8, CCL-20, IL-8, CXCL-10, CXCL-11, oligoadenylate synthetases (OAS) genes, and selectively activated activating transcription factor 6 (ATF6). PMID: 23011799
  23. Taken together, these data suggest a plausible strategy whereby the adenovirus produces a single RNA transcript capable of inhibiting a variety of members of the innate immune response, including OAS1. PMID: 22709583
  24. The OAS1 SNP rs2660 AA genotype was associated significantly with prostate cancer, whereas the GG genotype protected against prostate cancer. PMID: 21638280
  25. A single SNP in OAS1 (OR 9.79, p = 0.003) was associated with increased risk for West Nile encephalitis and paralysis (WNE/P). PMID: 21935451
  26. Polymorphisms in OAS1 is associated with multiple sclerosis. PMID: 21735172
  27. The pronounced difference in gene regulation between the OAS1 gene agrees with a functional difference between these genes, which must exist as a consequence of the lack of the 2-5A synthetase activity of the OASL protein. PMID: 19203244
  28. Show a significant association between the functional SNP at exon 7 SAS of OAS1 gene and the viral response to interferon in chronic hepatitis c patients. PMID: 21182542
  29. The authors report that expression of human herpesvirus 5 ORF94 protein leads to decreased 2',5'-oligoadenylate synthetase (OAS) expression in transfected cells with and without interferon stimulation. PMID: 21450824
  30. A functional OAS1 single nucleotide polymorphism, AA genotype, confers susceptibility to MS and the GG genotype may protect against increased disease activity. PMID: 20679634
  31. association between gene haplotypes and rubella virus-specific cytokine secretion in children immunized with rubella vaccine PMID: 20079393
  32. 2'-5' oligoadenylate synthetase 1 gene polymorphism in associated with hepatitis B susceptibility. PMID: 17963609
  33. The expression levels of both MX1 and OAS1 in systemic lupus erythematosus patients are up-regulated, and he expression levels of OAS1 genes are associated with SLE disease activity. PMID: 19462904
  34. OAS1 data suggest that there may be a weak association with type I diabetes for two OAS1 polymorphisms, rs3741981 and rs10774671, in populations of European descent. PMID: 19956105
  35. role in interferon-gamma inhibition of respiratory syncytial virus infection of human epithelial cells PMID: 11980899
  36. identification of the substrate-binding sites PMID: 11986302
  37. sequence motifs in OAS1 regulate polyadenylation PMID: 12082089
  38. Polymorphisms in the OSA1 gene is associated with outcome of hepatitis C virus infection PMID: 12944978
  39. This genetic polymorphism makes OAS1 an excellent candidate for a human gene that influences host susceptibility to viral infection. PMID: 15732009
  40. polymorphisms of two interferon-inducible genes OAS-1 and myxovirus resistance-A might affect susceptibility to the disease and progression of severe acute respiratory syndrome at each level PMID: 15766558
  41. OAS1 single nucleotide polymorphisms were significantly increased in diabetic compared with healthy siblings. PMID: 15855350
  42. Naturally mutated residues Lys404, Pro500 and Ser471 of E17 isozyme of 2',5'-oligoadenylate synthetase from a transgenic mouse serve an essential function in maintaining the enzyme activity of the protein. PMID: 15865429
  43. single nucleotide polymorphisms (SNPs) identified in OAS exons in hospitalized patients with West Nile Virus infection PMID: 16235172
  44. No evidence of association with either type 1 diabetic affcted or unaffected siblings in terms of relative risk. PMID: 16644715
  45. Polymorphisms within the OAS1 gene are associated with susceptibility to severe acute respiratory syndrome. PMID: 16824203
  46. findings indicate that the OAS1 gene polymorphisms may confer susceptibility to multiple sclerosis or serve as markers of functional variants and suggest that OAS1 activity is involved in the etiology of the disease PMID: 17092260
  47. Data identifies OAS1 single nucleotide polymorphism rs10774671 as a host genetic risk factor for initial infection with West Nile Virus in humans. PMID: 19247438
  48. The SNP of OAS-1 at the exon 3 of its coding sequence was associated with progression of disease in Japanese patients with HCV infection. PMID: 19515215
  49. Data show that the hepatitis C virus core protein specifically and effectively activates the 2'-5'oligoadenylate synthetase gene promoter. PMID: 19575500
  50. mechanism of 2'-5'-oligoadenylate synthetase activation by double stranded RNA was studied. PMID: 19665006

Show More

Hide All

Subcellular Location
Cytoplasm. Mitochondrion. Nucleus. Microsome. Endoplasmic reticulum. Secreted.
Protein Families
2-5A synthase family
Database Links

HGNC: 8086

OMIM: 164350

KEGG: hsa:4938

STRING: 9606.ENSP00000388001

UniGene: Hs.524760

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1