| Code | CSB-YP010899HU1 | 
| MSDS | |
| Size | Pls inquire | 
| Source | Yeast | 
| Have Questions? | Leave a Message or Start an on-line Chat | 
| Code | CSB-EP010899HU1 | 
| MSDS | |
| Size | Pls inquire | 
| Source | E.coli | 
| Have Questions? | Leave a Message or Start an on-line Chat | 
| Code | CSB-EP010899HU1-B | 
| MSDS | |
| Size | Pls inquire | 
| Source | E.coli | 
| Conjugate | Avi-tag Biotinylated E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.  | 
                  
| Have Questions? | Leave a Message or Start an on-line Chat | 
| Code | CSB-BP010899HU1 | 
| MSDS | |
| Size | Pls inquire | 
| Source | Baculovirus | 
| Have Questions? | Leave a Message or Start an on-line Chat | 
| Code | CSB-MP010899HU1 | 
| MSDS | |
| Size | Pls inquire | 
| Source | Mammalian cell | 
| Have Questions? | Leave a Message or Start an on-line Chat | 
There are currently no reviews for this product.
Regarding your protein CSB-EP010899HU, could you please provide some informations for all 4 expression hosts? I am specifically interested in their protein having a His-tag, so could you please advise on the likelihood of these proteins having this tag?
MMDVNSSGRPDLYGHLRSFLLPEVGRGLPDLSPDGGADPVAGSWAPHLLSEVTASPAPTWDAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYTIYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFPGFPRVEPDSVIALNGIVKLQKEVEECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTSCSCIPLWVERTFLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEALKLAERPERPEFVLRACTRRVLLRPEKRPPVSVWVLQSPDHHNWLADKMLTTVEKKVMIHD
MMDVNSSGRPDLYGHLRSFLLPEVGRGLPDLSPDGGADPVAGSWAPHLLSEVTASPAPTWDAPPDNASGCGEQINYGRVEKVV
I used a cell-free expression system and added liposomes to solubilize the membrane protein and this product was claimed that the solubilized protein was active but we could not test it nor use the preparation as the lipids interfered with the labeling reaction.
Do you add any liposomes/lipids to this product in order to solubilize it, or how else do you ensure that it is soluble?