Name: Recombinant Human 5-hydroxytryptamine receptor 7 (HTR7), partial
Brand: CUSABIO
SKU: 010899HU1

Product Details

Purity

>85% (SDS-PAGE)

Target Names

HTR7

Uniprot No.

P34969

Alternative Names

HTR7; 5-hydroxytryptamine receptor 7; 5-HT-7; 5-HT7; 5-HT-X; Serotonin receptor 7

Species

Homo sapiens (Human)

Protein Length

Partial

Tag Info

Tag type will be determined during the manufacturing process.

The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer before Lyophilization

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

Regarding your protein CSB-EP010899HU, could you please provide some informations for all 4 expression hosts? I am specifically interested in their protein having a His-tag, so could you please advise on the likelihood of these proteins having this tag?

Thanks for your inquiry. The product details are confirmed as below.
Recombinant Human 5-hydroxytryptamine receptor 7(HTR7)
CSB-CF010899HU
Expression Region:1-479aa; Full length.
Tag information:Tag type will be determined during the manufacturing process.
Sequence:

MMDVNSSGRPDLYGHLRSFLLPEVGRGLPDLSPDGGADPVAGSWAPHLLSEVTASPAPTWDAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYTIYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFPGFPRVEPDSVIALNGIVKLQKEVEECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTSCSCIPLWVERTFLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEALKLAERPERPEFVLRACTRRVLLRPEKRPPVSVWVLQSPDHHNWLADKMLTTVEKKVMIHD

Recombinant Human 5-hydroxytryptamine receptor 7(HTR7),partial
CSB-YP010899HU1 >> Yeast
CSB-EP010899HU1 >> E.coli
CSB-BP010899HU1 >> Baculovirus
CSB-MP010899HU1 >> Mammalian cell
Expression Region:1-83aa; Partial, provide the first complete extracellular domain at the N-terminal.
Tag information:EP, YP, BP, MP: Tag type will be determined during the manufacturing process.
Sequence:

MMDVNSSGRPDLYGHLRSFLLPEVGRGLPDLSPDGGADPVAGSWAPHLLSEVTASPAPTWDAPPDNASGCGEQINYGRVEKVV

We can give priority to meet your demand for His-tag, pls confirm the N-terminal or C-terminal ? 6*His or 10*His ?
Pls remark this information when placing the order. And the successful rate for expressing this protein with your desired tag is 95.25%.
This protein is a receptor, if you want to use it for function assays, we recommend the cell free expressed protein,
because it is expressed in full length and theoretically can be used for functional determination, but we have not done related experiments.

I used a cell-free expression system and added liposomes to solubilize the membrane protein and this product was claimed that the solubilized protein was active but we could not test it nor use the preparation as the lipids interfered with the labeling reaction.
Do you add any liposomes/lipids to this product in order to solubilize it, or how else do you ensure that it is soluble?

Regarding your inquiry about CSB-CF010899HU, pls check our reply as follows:
In general, the extraction, dissolution and purification of membrane proteins can be manipulated with detergents.
That is, the dissolution of the membrane protein only needs the detergent.
The liposome-membrane protein complex is not a water-soluble state, more similar to the suspension, which may interfere with some detection reactions.
We routinely prepare membrane proteins with detergents, and ultimately provide the product in a soluble form.

Target Background

Function

This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that stimulate adenylate cyclase.

Gene References into Functions

Related GPCRs couple differently to Gs: preassociation between G protein and 5-HT7 serotonin receptor reveals movement of Galphas upon receptor activation. PMID: 29079700
The dizygotic twins presented here carry a compound heterozygous variant in the HTR7 gene. No other coding sequence abnormalities (CNVs and SVs) were observed in their fully sequenced genomes consistent with either dominant or recessive inheritance. This provides a first suggestive genetic link between the 5-HT7 receptor and autism spectrum disorder in patients. PMID: 27380831
Placental expression of HTR7 was significantly increased in women with pre-eclampsia compared to controls. PMID: 26797415
PTP1B directly regulates STAT5 phosphorylation and its activation via the cAMP/PKA pathway downstream of the 5-HT7 receptor is involved in the suppression of beta-casein expression in MCF-12A cells PMID: 27016479
Study shows that HTR7 variants are not related to the overall improvement in schizophrenia symptoms following perospirone or aripiprazole treatment PMID: 26609891
Study demonstrated that binding of clozapine or olanzapine to the 5-HT7 receptor leads to antagonist-mediated lysosomal degradation by exposing key residues in the C-terminal tail that interact with GASP-1 PMID: 25706089
This is a review of literature about how 5-HT7 receptor has been implicated in cognitive disturbances, sleep and circadian rhythmicity disorders, anxiety and depression PMID: 25228519
Genetic variations in HTR7 serotonin receptor contribute to the predisposition for alcohol dependence. PMID: 25070732
There is a cross-reactivity between 5-HT7 and 5-HT1A receptors and in this review they are shown to have a role in depressive disorders. PMID: 24935787
the expression of 5-HT7 receptors in brain tissues was higher in the epilepsy group compared with the nonepileptic group; the results suggested that 5-HT7 receptors participate in the pathogenesis of temporal lobe epilepsy PMID: 22543085
The interaction between RhoBTB3 and the 5-HT7a receptor strongly inhibits proteasomal degradation of the 5-HT7a receptor. PMID: 22245496
The role of the 5-HT7 receptor in the central nervous system, is discussed. PMID: 21424680
The association with rs7916403 in serotonin receptor gene HTR7 on chromosome 10q23 (combined P = 1.53 x 10), implicates the serotonergic system in the neurophysiological underpinnings of theta event-related brain oscillations. PMID: 21184583
Ability of non-inactivating drugs to bind h5-HT(7) orthosteric sites and reverse wash-resistant effects of risperidone/9-OH-risperidone, also bound to h5-HT(7) orthosteric sites, is evidence for protomer-protomer interactions between h5-HT(7) homodimers. PMID: 20827463
HEK293 cells stably or transiently expressing either of the 5-HT7 receptor splice variants show elevated basal adenylyl cyclase (AC) activity as well as concentration-dependent inhibition of basal AC activity by 5-HT7 antagonists (inverse agonism). PMID: 11906971
The decrease in affinity of 5-HT and other 5-HT receptor agonists at the (Thr92Lys) h5-HT7 receptor may be associated with changes of sleep physiology and of actions of new 5-HT7 receptor agonists designed to treat circadian dysregulation. PMID: 15896881
HTR7 is a susceptibility gene for schizophrenia in this Japanese group. PMID: 16192982
This may indicate that the h5-HT7 receptor is part of a subfamily of G-protein-coupled receptors (GPCRs) possessing this property or that many GPCRs have the potential to be irreversibly blocked, but only select drugs can induce this effect. PMID: 16870886
These observations suggest that PLAC-24 may play a role in the transport and the stabilisation of newly synthesised 5-HT(7) receptor towards the plasma membrane. PMID: 16935469
Results support the essential role of Sp factors in regulating 5-HT(7) promoter activity. PMID: 17321075
data demonstrate a role for sphingomyelin and gangliosides in regulating binding of [(3)H]5-HT to 5-HT(7) receptors; these observations further strengthen that actions of 5-HT via 5-HT(7) receptors are dependent upon lipid raft integrity PMID: 17428232
Caveolin-1, specifically localized in cholesterol-enriched lipid rafts, appears to regulate constitutive and agonist-stimulated cell surface levels of 5-HT7 receptors via a clathrin-independent mechanism. PMID: 17936759
Data show that 5-HT(7) receptors are involved in the modulation of learning and memory processes. PMID: 18243350
The results of this study demonstrate that variations in the HTR7 gene may not be good genetic markers for predicting the therapeutic efficacy of risperidone. PMID: 19233240

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein.

Protein Families

G-protein coupled receptor 1 family

Tissue Specificity

Isoform A is the predominant isoform in spleen, caudate and hippocampus. Isoform B is expressed at lower levels. Isoform D is a minor isoform in terms of expression.

Database Links

HGNC: 5302

OMIM: 182137

KEGG: hsa:3363

STRING: 9606.ENSP00000337949

UniGene: Hs.73739

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：

Code	CSB-YP010899HU1
MSDS	MSDS
Size	Pls inquire
Source	Yeast
Have Questions?	Leave a Message or Start an on-line Chat

Code	CSB-EP010899HU1
MSDS	MSDS
Size	Pls inquire
Source	E.coli
Have Questions?	Leave a Message or Start an on-line Chat

Code	CSB-EP010899HU1-B
MSDS	MSDS
Size	Pls inquire
Source	E.coli
Conjugate	Avi-tag Biotinylated E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions?	Leave a Message or Start an on-line Chat

Code	CSB-BP010899HU1
MSDS	MSDS
Size	Pls inquire
Source	Baculovirus
Have Questions?	Leave a Message or Start an on-line Chat

Code	CSB-MP010899HU1
MSDS	MSDS
Size	Pls inquire
Source	Mammalian cell
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human 5-hydroxytryptamine receptor 7 (HTR7), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage