Recombinant Human 60S acidic ribosomal protein P2 (RPLP2), partial

In Stock
Code CSB-EP020342HU1
Abbreviation Recombinant Human RPLP2 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
RPLP2
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
2700049I22Rik; 60S acidic ribosomal protein P2; Acidic ribosomal phosphoprotein P2; D11S2243E; LP2; MGC71408; OTTMUSP00000029428; OTTMUSP00000029429; OTTMUSP00000029430; P2; Renal carcinoma antigen NY-REN-44; Ribosomal protein P2; Ribosomal protein, large, P2; RLA2_HUMAN; rplP2; RPP2
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-113aa
Target Protein Sequence
MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
38.4kDa
Protein Length
Partial
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays an important role in the elongation step of protein synthesis.
Gene References into Functions
  1. Collectively, the present results suggest that PhoRpp21 binds the loop between P11 and P12 helices through overall positively charged clusters on the surface of the complex and serves as a scaffold for PhoRpp29 to optimize structural conformation of its N-terminal helix (alpha2) in PhoRpp21, as well as C-terminal residues in PhoRpp29, for RNase P activity. PMID: 27810361
  2. Results show that the conserved C-terminal segment of P2 from three different eukaryotic species- Human, Plasmodium falciparum and Toxoplasma gondii is intrinsically disordered. PMID: 25412900
  3. relevance of the observed cross-reactive IgE autoantibodies against P2 proteins in systemic lupus eryth remains to be elucidated PMID: 21410706
  4. the eukaryotic stalk protein P2 forms a symmetric homodimer in solution, and is structurally distinct from the bacterial counterpart L12 homodimer. PMID: 20385603
  5. Ribosomal protein P2 has been identified as a novel substrate of GRK2 in HEK-293 cells where P2 phosphorylation is increased following agonist stimulation of the beta 2-adrenergic receptor under conditions of tyrosine kinase PKC and PKA inhibition. PMID: 12379128
  6. Antisense-mediated depletion may disrupt the proteome of cancer cells. PMID: 14981896
  7. Distinct roles for CD39 and P2-purinergic signaling in both tissue remodeling and fibrogenesis with respect to human pancreatic diseases. PMID: 16920697

Show More

Hide All

Protein Families
Eukaryotic ribosomal protein P1/P2 family
Database Links

HGNC: 10377

OMIM: 180530

KEGG: hsa:6181

STRING: 9606.ENSP00000322419

UniGene: Hs.437594

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*