Recombinant Human 60S acidic ribosomal protein P2(RPLP2)

Code CSB-EP020342HU
Size US$1726
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP020342HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) RPLP2.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP020342HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) RPLP2.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 85% as determined by SDS-PAGE.
Target Names RPLP2
Uniprot No. P05387
Research Area Cancer
Alternative Names 2700049I22Rik; 60S acidic ribosomal protein P2; Acidic ribosomal phosphoprotein P2; D11S2243E; LP2; MGC71408; OTTMUSP00000029428; OTTMUSP00000029429; OTTMUSP00000029430; P2; Renal carcinoma antigen NY-REN-44; Ribosomal protein P2; Ribosomal protein, large, P2; RLA2_HUMAN; rplP2; RPP2
Species Homo sapiens (Human)
Source E.coli
Expression Region 1-115aa
Target Protein Sequence MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 15.7 kDa
Protein Length Full Length
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Plays an important role in the elongation step of protein synthesis.
Gene References into Functions
  1. Collectively, the present results suggest that PhoRpp21 binds the loop between P11 and P12 helices through overall positively charged clusters on the surface of the complex and serves as a scaffold for PhoRpp29 to optimize structural conformation of its N-terminal helix (alpha2) in PhoRpp21, as well as C-terminal residues in PhoRpp29, for RNase P activity. PMID: 27810361
  2. Results show that the conserved C-terminal segment of P2 from three different eukaryotic species- Human, Plasmodium falciparum and Toxoplasma gondii is intrinsically disordered. PMID: 25412900
  3. relevance of the observed cross-reactive IgE autoantibodies against P2 proteins in systemic lupus eryth remains to be elucidated PMID: 21410706
  4. the eukaryotic stalk protein P2 forms a symmetric homodimer in solution, and is structurally distinct from the bacterial counterpart L12 homodimer. PMID: 20385603
  5. Ribosomal protein P2 has been identified as a novel substrate of GRK2 in HEK-293 cells where P2 phosphorylation is increased following agonist stimulation of the beta 2-adrenergic receptor under conditions of tyrosine kinase PKC and PKA inhibition. PMID: 12379128
  6. Antisense-mediated depletion may disrupt the proteome of cancer cells. PMID: 14981896
  7. Distinct roles for CD39 and P2-purinergic signaling in both tissue remodeling and fibrogenesis with respect to human pancreatic diseases. PMID: 16920697

Show More

Hide All

Protein Families Eukaryotic ribosomal protein P1/P2 family
Database Links

HGNC: 10377

OMIM: 180530

KEGG: hsa:6181

STRING: 9606.ENSP00000322419

UniGene: Hs.437594

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1