Recombinant Human 60S acidic ribosomal protein P2(RPLP2)

Code CSB-EP020342HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P05387
Relevance Plays an important role in the elongation step of protein synthesis.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP020342HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) RPLP2.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP020342HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) RPLP2.
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD
Research Area Cancer
Source E.coli
Gene Names RPLP2
Protein Names Large ribosomal subunit protein P2 Renal carcinoma antigen NY-REN-44 D11S2243E, RPP2
Expression Region 1-115aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 15.7 kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Plays an important role in the elongation step of protein synthesis.
Protein Families Eukaryotic ribosomal protein P1/P2 family
Database Links

HGNC: 10377

OMIM: 180530

KEGG: hsa:6181

STRING: 9606.ENSP00000322419

UniGene: Hs.437594

Related Products

RPLP2 Antibodies

RPLP2 Antibodies for Homo sapiens (Human)

RPLP2 Antibodies for Human

RPLP2 Proteins

RPLP2 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.