Recombinant Human ADP-ribosylation factor-like protein 2-binding protein(ARL2BP)

Code CSB-EP897097HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. Q9Y2Y0
Relevance Together with ARL2, plays a role in the nuclear translocation, retention and transcriptional activity of STAT3. May play a role as an effector of ARL2.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Binder of ARF2 protein 1
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYISLVEKYIEEQLLQRIPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLSSGLVVTSLCKSSSLPASQNNLRH
Research Area Signal Transduction
Source E.coli
Gene Names ARL2BP
Expression Region 1-163aa
Tag Info N-terminal GST-tagged
Mol. Weight 45.8kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Together with ARL2, plays a role in the nuclear translocation, retention and transcriptional activity of STAT3. May play a role as an effector of ARL2.
Involvement in disease Retinitis pigmentosa with or without situs inversus (RPSI)
Subcellular Location Cytoplasm, Mitochondrion intermembrane space, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, Nucleus, Cytoplasm, cytoskeleton, spindle, Cytoplasm, cytoskeleton, cilium basal body
Protein Families ARL2BP family
Tissue Specificity Expressed in retina pigment epithelial cells (at protein level). Widely expressed.
Database Links

HGNC: 17146

OMIM: 615407

KEGG: hsa:23568

STRING: 9606.ENSP00000219204

UniGene: Hs.632873

Related Products

ARL2BP Antibodies

ARL2BP Antibodies for Homo sapiens (Human)

ARL2BP Proteins

ARL2BP Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.