Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Signal Transduction
Alternative Names
ADP ribosylation factor like 2 binding protein; ADP-ribosylation factor-like protein 2-binding protein; AR2BP_HUMAN; Arf like 2 binding protein BART1; ARF-like 2-binding protein; ARL2 binding protein; Arl2bp; ARL2BP protein; BART; BART1; Binder of ARF2 protein 1; Binder of Arl Two; Binder of Arl2; Retinitis pigmentosa 66 (autosomal recessive); RP66
Species
Homo sapiens (Human)
Expression Region
1-163aa
Target Protein Sequence
MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYISLVEKYIEEQLLQRIPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLSSGLVVTSLCKSSSLPASQNNLRH
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The region for expressing recombinant Human ARL2BP contains amino acids 1-163. The theoretical molecular weight of the ARL2BP protein is 45.8 kDa. The ARL2BP protein was expressed in e.coli. The N-terminal GST tag was fused into the coding gene segment of ARL2BP, making it easier to detect and purify the ARL2BP recombinant protein in the later stages of expression and purification.
The human ADP-ribosylation factor-like protein 2-binding protein (ARL2BP) is a protein that interacts with ARL2, an ADP-ribosylation factor-like protein involved in intracellular vesicle trafficking. ARL2BP has been implicated in processes related to cellular organization and vesicle transport. It may play a role in microtubule dynamics and centrosome function. Research on ARL2BP aims to uncover its specific cellular functions, interactions with ARL2, and its potential involvement in cellular processes critical for overall cell function and organization.
