Recombinant Human ATP-binding cassette sub-family G member 1 (ABCG1), partial

Code CSB-YP001080HU1
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP001080HU1
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP001080HU1-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP001080HU1
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP001080HU1
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
ABCG1; ABC8; WHT1; ATP-binding cassette sub-family G member 1; ATP-binding cassette transporter 8; White protein homolog
Species
Homo sapiens (Human)
Expression Region
1-426
Target Protein Sequence
MACLMAAFSVGTAMNASSYSAEMTEPKSVCVSVDEVVSSNMEATETDLLNGHLKKVDNNL TEAQRFSSLPRRAAVNIEFRDLSYSVPEGPWWRKKGYKTLLKGISGKFNSGELVAIMGPS GAGKSTLMNILAGYRETGMKGAVLINGLPRDLRCFRKVSCYIMQDDMLLPHLTVQEAMMV SAHLKLQEKDEGRREMVKEILTALGLLSCANTRTGSLSGGQRKRLAIALELVNNPPVMFF DEPTSGLDSASCFQVVSLMKGLAQGGRSIICTIHQPSAKLFELFDQLYVLSQGQCVYRGK VCNLVPYLRDLGLNCPTYHNPADFVMEVASGEYGDQNSRLVRAVREGMCDSDHKRDLGGD AEVNPFLWHRPSEEVKQTKRLKGLRKDSSSMEGCHSFSASCLTQFCILFKRTFLSIMRDS VLTHLR
Protein Length
Cytoplasmic domain
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the efflux of phospholipids such as sphingomyelin, cholesterol and its oxygenated derivatives like 7beta-hydroxycholesterol and this transport is coupled to hydrolysis of ATP. The lipid efflux is ALB-dependent. Is an active component of the macrophage lipid export complex. Could also be involved in intracellular lipid transport processes. The role in cellular lipid homeostasis may not be limited to macrophages. Prevents cell death by transporting cytotoxic 7beta-hydroxycholesterol.
Gene References into Functions
  1. HSP70 suppresses the expression of ABCA1 and ABCG1 through preventing Elk-1 from binding to the promoter of ABCA1 and ABCG1 in human THP-1-derived macrophages. PMID: 29678642
  2. Downregulation of ABCG1 in macrophages promoted atherosclerotic lesions. PMID: 30393020
  3. High ABCG1 expression is associated with glioma. PMID: 26981778
  4. ABCG1 regulates pulmonary surfactant metabolism PMID: 28264879
  5. Hepatic free cholesterol content was significantly increased in NASH as compared to non-NASH subjects, while ABCA1 and ABCG1 protein levels significantly decreased with NASH and fibrosis progression. The relative expression of miR-33a and miR-144 correlated inversely with ABCA1 but not with ABCG1 protein levels. miR-33a/144 and their target gene ABCA1 may contribute to the pathogenesis of NASH in morbidly obese subjects. PMID: 26945479
  6. Understanding the relationship between cholesterol and inflammation in the lung, and the role that ABC transporters play in this may illuminate new pathways to target for the treatment of inflammatory lung diseases PMID: 28241820
  7. Findings suggest that the ABCG1-mediated efflux of cholesterol, but not of 7-ketocholesterol, shows specificity for structural domains of apoA-I bound to reconstituted HDL. Although the mid region alone of apoA-I associated to rHDL can promote ABCG1-mediated cholesterol efflux, deletion of carboxyl-terminal region 185-243 from full-length apoA-I diminishes ABCG1-mediated cholesterol efflux. PMID: 23826352
  8. ABCG1 regulates T cell differentiation into Tregs, highlighting a pathway by which cholesterol accumulation can influence T cell homeostasis in atherosclerosis PMID: 27482882
  9. ABCG1 and ABCG4 alter the distribution of gamma-secretase on the plasma membrane, leading to the decreased gamma-secretase activity and suppressed Abeta secretion PMID: 27196068
  10. Both the full-length and the short isoforms of ABCG1 can dimerize with ABCG4, whereas the ABCG2 multidrug transporter is unable to form a heterodimer with ABCG4. PMID: 27228027
  11. DNA methylation at the ABCG1 locus cg06500161 in blood DNA was associated with an increased risk for future type2 diabetes. PMID: 27148772
  12. we have newly identified a haplotype-tagging SNP, rs225396, in ABCG1 to be associated with PCV and nAMD in Chinese and Japanese cohorts. This provides new evidence to support ABCG1 as a susceptibility gene for PCV and nAMD. PMID: 27787563
  13. ABCG1 gene expression positively correlated with obesity indicators. PMID: 27420620
  14. Our results indicated that genetic variants of ABCG1 may be predictors of survival of nonsmall-cell lung cancer patients PMID: 26757251
  15. This review focuses on the role of ABC transporters A1 and G1 in the pathogenesis of atherosclerosis PMID: 27239842
  16. Leu at position 550/562 in mABCG1/hABCG1 is critical for their plasma membrane localization but not for ABCG1-mediated cholesterol efflux. PMID: 26695502
  17. ABCG1 polymorphisms are associated with reduced risk of developing ischemic stroke in hypertriglyceridemic population and atherothrombotic stroke in this cohort of Chinese Han population. PMID: 25890853
  18. Data suggest that ligand-induced activation of RAGE (advanced glycosylation end product-specific receptor) down-regulates ABCG1-mediated cholesterol efflux from macrophages leading to diabetic angiopathies and atherosclerotic plaques. PMID: 26253613
  19. Propofol up-regulates expression of ABCA1, ABCG1, and SR-B1 through the PPARgamma/LXRalpha pathway in THP-1 macrophage-derived foam cells. PMID: 25600616
  20. Expression analysis revealed an association between ABCG1 methylation and lipid levels that might be partly mediated by ABCG1 expression. PMID: 25583993
  21. HUWE1 and NEDD4-1 are two E3 ligases that are fundamental enzymes in the post-translational regulation of ABCG1 and ABCG4 protein levels and cellular cholesterol export activity PMID: 26296893
  22. These findings indicate that SNP rs1893590 of ABCG1 has a significant impact over HDL-C under asymptomatic clinical conditions in an age and BMI dependent way. PMID: 25398214
  23. ABCG1 promoter rs57137919G>A variant had an allele-specific effect on ABCG1 expression and was associated with an increased apoptosis in cholesterol-loaded macrophages. PMID: 24972087
  24. The present review summarizes the current knowledge and views on the regulatory role of CAV1 on the cholesterol homeostasis with emphasis on the association of CAV1 with ABCA1 and ABCG1. [review] PMID: 24801727
  25. Hyperalphalipoproteinemics present a decrease in hsa-miR-33a and higher mRNA expression of ABCA1 and ABCG1. PMID: 26051418
  26. ABCG1 can interact with cholesterol via a functional CRAC domain (cholesterol recognition/interaction amino acid consensus motifs). PMID: 25732853
  27. Ang-(1-7) upregulates ABCA1 and ABCG1 expression. PMID: 25225013
  28. These results suggest that ABCA1, ABCG1, and ABCG4 are localized to distinct membrane meso-domains and disturb the meso-domain structures by reorganizing lipids on the plasma membrane PMID: 25302608
  29. The role of cellular cholesterol transport proteins including adenosine triphosphate binding cassette transporter A1 (ABCA1), G1 (ABCG1) and scavenger receptor class B type I (SR-BI) in diabetic nephropathy, was determined. PMID: 25181357
  30. promoter DNA hypermethylation of the ABCG1 and GALNT2 genes, but not the HMGCR gene, is associated with an increased risk of CHD. PMID: 25084356
  31. The study identifies a major role of adipocyte ABCG1 in adiposity and fat mass growth and suggests that adipose ABCG1 might represent a potential therapeutic target in obesity. PMID: 25249572
  32. knock-outs display expansion of B-1 B cells, which secrete natural Abs that protect from atherosclerosis PMID: 25339664
  33. Decrease in the ABCG1 gene expression in macrophages is associated with atherosclerosis. PMID: 25509420
  34. I human macrophages, polyunsaturated fatty acids such as EPA have an effect on the cholesterol homeostasis in macrophages, and they can change the expression of ABCG1 gene. PMID: 24901717
  35. Generation of extracellular cholesterol microdomains is mediated by ABCG1. PMID: 24212237
  36. These findings indicate that CAV1 interacts with ABCG1 and regulates ABCG1-mediated cholesterol efflux. PMID: 24576892
  37. Data suggest that in placentas from women with pre-eclampsia, expression of ABCA1 (ABC transporter 1) is down-regulated in apical membrane of villous syncytiotrophoblast and in villous fetal endothelial cells; expression of ABCG1 is unchanged. PMID: 23880356
  38. results suggest that reduction of ABCG1 induces endothelial apoptosis, which seems associated with intracellular free cholesterol accumulation and subsequent ER stress PMID: 23897420
  39. Our results showed that CETP is a susceptibility gene for neovascular age-related macular degeneration and polypoidal choroidal vasculopathy (PCV) and that ABCG1 a putative gene for PCV. PMID: 24393350
  40. No significant associations were detected for the ABCB6 or ABCG1 gene PMID: 24192121
  41. ABCA1 and ABCG1 ubiquitination and degradation are regulated by cellular cholesterol PMID: 24500716
  42. MiR-128-2 inhibits the expression of ABCA1, ABCG1 and RXRalpha directly through a miR-128-2-binding site within their respective 3'untranslated regions. PMID: 23990020
  43. Two highly conserved residues, Asn and Phe, play an important role in ABCG1-dependent export of cellular cholesterol through the regulation of ABCG1 trafficking. PMID: 24320932
  44. LXRalpha plays a central role in neopterin-induced downregulation of ABCA1 and ABCG1 in THP-1 macrophage-derived foam cells. PMID: 23564066
  45. Our data suggest that MCP-1 impairs RCT activity in HepG2 cells by a PI3K/Akt-mediated posttranslational regulation of ABCA1, ABCG1, and SR-BI cell-surface expression. PMID: 23402987
  46. Evidence is presented for the first time suggesting that resveratrol is able to activate ABCG1 activity by an alternative mechanism that involves an indirect interaction PMID: 23770099
  47. Endothelial dysfunction induced by high glucose is associated with decreased ABCG1 expression. PMID: 22365996
  48. ABCG1 is an active lipid transporter and possesses different binding sites for cholesterol and sphingomyelin PMID: 23172659
  49. Genetic variations in ABCA1 and ABCG1 were not associated with increased risk of type 2 diabetes in the general population. PMID: 23139370
  50. These data indicate that ABCA1, ABCG1, and SR-BI are reduced in various populations under subclinically inflammatory conditions, which may potentially lead to impairing reverse cholesterol transport and developing atherosclerosis. PMID: 22614118

Show More

Hide All

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Cell membrane. Note=Predominantly localized in the intracellular compartments mainly associated with the endoplasmic reticulum (ER) and Golgi membranes.
Protein Families
ABC transporter superfamily, ABCG family, Eye pigment precursor importer (TC 3.A.1.204) subfamily
Tissue Specificity
Expressed in several tissues. Expressed in macrophages; expression is increased in macrophages from patients with Tangier disease.
Database Links

HGNC: 73

OMIM: 603076

KEGG: hsa:9619

STRING: 9606.ENSP00000354995

UniGene: Hs.124649

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1