Recombinant Human Annexin A5(ANXA5)

In Stock
Code CSB-YP001846HU
Size US$1916Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names ANXA5
Uniprot No. P08758
Research Area Cardiovascular
Alternative Names Anchorin CII; Annexin 5; Annexin A5; Annexin V; Annexin-5; Annexin5; AnnexinA5; AnnexinV; ANX 5; ANX A5; ANX5; ANXA5; ANXA5_HUMAN; Calphobindin I; CBP-I; Endonexin II; ENX 2; ENX2; Lipocortin V; PAP I; PAP-I; Placental anticoagulant protein 4; Placental anticoagulant protein I; PLACENTAL PROTEIN 4; PP 4; Pp4; RPRGL3; Thromboplastin inhibitor; VAC-alpha; Vascular anticoagulant-alpha
Species Homo sapiens (Human)
Source Yeast
Expression Region 2-320aa
Target Protein Sequence AQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 37.8kDa
Protein Length Full Length of Mature Protein
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function This protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade.
Gene References into Functions
  1. AnxA5 2D-network mediates E-cadherin mobility in the plasmalemma that triggers human trophoblasts aggregation and thereby cell fusion. PMID: 28176826
  2. Caspase-3 and -8 and annexin V may serve as diagnostic markers in Ovarian cancer , also explained that the decrement in control of the S phase in the cell cycle may considered one of the significant factors in the development of ovarian tumors PMID: 30197345
  3. When ANXA5 expression increased, cell proliferation was inhibited by regulating the expression of bcl-2 and bax while cell metastasis was suppressed by regulating E-cadherin and MMP-9 expression. PMID: 30010106
  4. Maternal carriers of the ANXA5 M2 haplotype has greater risk of developing placenta-mediated pregnancy complications, such as preeclampsia and intrauterine growth restriction. PMID: 29497952
  5. The domain IV-truncated form of anxA5 is impaired in binding phosphatidylserine liposome and apoptotic cells, and anticoagulation activity. PMID: 29257055
  6. increase in VEGF and Apelin, and decrease in Annexin A5 supports roles of hemo-dynamic alterations in fetoplacental circulation and structural alterations in uteroplacental bed occurring in preeclampsia. PMID: 29208172
  7. In patients with colon cancer, annexin A5 expression in cancer tissues is related to lymph node metastasis and tumor grade. Serum level of annexin A5 is related to annexin A5 expression in cancer tissues. PMID: 29093625
  8. annexin A5 anticoagulant has a role in adverse outcomes in antiphospholipid antibody positive patients with thrombosis or pregnancy complications PMID: 28393472
  9. There was no significant difference in circulating ANXA5 levels between subjects of the non-pregnant, RPL and parous groups (median, 0.25 ng/ml vs. 0.21 ng/ml vs. 0.01 ng/ml, p = 0.14) (Fig. 1A ). Similarly, no significant differences in circulating ANXA5 levels were observed across these three clinical subgroups among M2-carriers or non-carriers, respectively. PMID: 28605660
  10. Serum annexin A5 level was not altered in pre-eclampsia. PMID: 28501283
  11. Annexin A5 was proposed to use in detection of apoptosis. associated with the Breast Cancer. Upregulation of the AA5 protein is detected in Pleomorphic Adenoma of the Parotid Gland. PMID: 28497265
  12. Physiological function of ANXA5 as an embryonic anticoagulant that appears deficient in contiguous specter of thrombophilia-related pregnancy complications culminating more frequently in miscarriage in a maternal M2 carrier background. PMID: 28900802
  13. This study confirmed the proposed role of M2/ANXA5 as embryonic, genetically associated thrombophilia predisposition factor for early recurrent pregnancy loss among ethnic Malay of Malaysia. PMID: 28108842
  14. Circulating anxA5 levels are associated with carotid intima-media thickness but not coronary plaque composition in high-risk patients with diabetes mellitus. PMID: 28592134
  15. Results showed that ANXA5 rs1050606 was significantly associated with left ventricular hypertrophy in Chinese endogenous hypertension patients. PMID: 29095261
  16. Moreover, mechanism study exhibited that Annexin A5 could activate PI3K/Akt/mTOR signaling pathway, promote epithelial-mesenchymal transition (EMT) and the expression of MMP2 and MMP9. Annexin A5 may be a potential prognostic biomarker in RCC and promotes proliferation, migration and invasion of RCC cells via activating PI3K/Akt/mTOR signaling pathway and regulating EMT process and MMP expression. PMID: 28393205
  17. human myotubes rendered deficient for Annexin-A5 (AnxA5) suffer from a severe defect in membrane resealing. PMID: 27286750
  18. This study functionally characterized allelic variants in the ANXA5 promoter, both alone and in combinations, and the results suggest that combinations of several individual variants contribute to modulate the ANXA5 transcriptional activity, most likely through binding of nuclear factors. PMID: 27318245
  19. Chronically increased alveolar annexin V levels, as reflected in increased idiopathic pulmonary fibrosis (IPF) BALF levels, may contribute to the progression of IPF by inducing the release of pro-fibrotic mediators. PMID: 26160872
  20. lower exhaled breath condensate annexin A5 levels in children with exercise-induced asthma compared to non-exercised-induced one PMID: 25796304
  21. The M2 haplotype is a risk factor for early spontaneous abortions, before the 12th week of gestation, and confers about the same relative risk to carriers of both sexes. PMID: 26371709
  22. annexin A5 promoter haplotype M2 may not have a role in recurrent pregnancy loss in Estonia or Denmark PMID: 26135579
  23. Annexin V is fused to an enzyme, creating a fusion protein that converts nontoxic drug precursors, prodrugs, into anticancer compounds while bound to the tumor, therefore mitigating the risk of side effects. PMID: 25899647
  24. Neither the M1/M2 haplotypes nor the tag SNPs in ANXA5 were convincingly associated with pregnancy related venous thromboembolism. PMID: 25495894
  25. Anx5 could protect cardiomyocytes adherens junctions and improve myocardial contractile function via regulation of p120 and anti-inflammation in LPS-induced endotoxemia. PMID: 25799159
  26. The associated male partner risk confirms the proposed role of M2/ANXA5 as a genetic trait impeding embryonic anticoagulation. PMID: 25682309
  27. AnxA5 promotes membrane resealing of injured human trophoblasts. PMID: 25595530
  28. ANXA5 haplotypes/plasma ANXA5 levels were not associated with carotid IMT progression or cardiovascular disease risk in familial hypercholesterolemia patients. PMID: 25525746
  29. The prognostic value of AnV and T cell apoptosis was evaluated in children with nephrotic syndrome in this review. PMID: 25661914
  30. study found neither individual SNPs nor any of the four haplotypes within the ANXA5 gene upstream region were associated with deep venous thrombosis in the Dutch population PMID: 25382354
  31. Lower incidence of M2/ANXA5 carriage in recurrent pregnancy loss patients with elevated lipoprotein(a) levels. PMID: 24335248
  32. Polycystic ovary syndrome subjects showed increased annexin V positive microparticle concentrations compared with healthy volunteers. PMID: 25336711
  33. Annexin A5 inhibits DLBCL cell invasion, MMP-9 expression/activity, and chemoresistance to CHOP through a PI3K-dependent mechanism. PMID: 25323007
  34. Data show involvement of ANXA5 and ILKAP in susceptibility to malignant melanoma PMID: 24743186
  35. annexin A5 promotes GBM cell invasion, MMP-2 expression/activity, and chemoresistance to temozolomide through a PI3K-dependent mechanism. PMID: 25245332
  36. Modified forms of LDL activate human T cells through dendritic cells. Annexin A5 inhibits these effects and promotes induction of regulatory T cells. PMID: 25395618
  37. The annexin 5 in serums of pregnant women and patients with particular types of cancer PMID: 25080795
  38. This review describes the structure, function and genetic expression of ANXA5, as well as its possible implication in recurrent pregnancy loss. PMID: 24152411
  39. We could not prove any association of ANX5 antibodies and systemic lupus erythematosis. PMID: 24872142
  40. genetic association studies in population in Japan: Data suggest that hypomorphic alleles in ANXA5 promoter in placenta (that is, fetal alleles), but not in maternal blood, contributes to onset of pre-eclampsia. PMID: 24140079
  41. This study demonstrated the significant changes in AnxV levels and its function in type 1 diabetic patients. PMID: 24423325
  42. Annexin A5 binds in a cooperative manner to to phosphatidylserine on apoptotic cell membranes. Shrunken apoptotic cells showed the highest Hill coefficient values. PMID: 24304966
  43. frequency of annexin A5 (-1C/T) polymorphism was higher in systemic lupus erythematosus related groups but did not correlate with recurrent pregnancy loss (RPL) or annexin A5 level; anti-annexin A5 IgM level was higher among antiphospholipid syndrome patients and was associated with RPL PMID: 24600987
  44. Annexin-V modified substrate was constructed via layer-by-layer (LBL) method for specific capture of early stage apoptotic Jurkat cells. PMID: 24021657
  45. annexin A5 may play a crucial role in cisplatin-induced toxicity by mediating the mitochondrial apoptotic pathway via the induction and oligomerization of VDAC. PMID: 24318879
  46. Suggest that annezin A5 IgG plays a significant role in producing a hypercoagulable state in primary and secondary antiphospholipid syndrome. PMID: 23981755
  47. Variations within the ANXA5 gene upstream region were confirmed to be risk factors of recurrent pregnancy loss. PMID: 23850300
  48. rs11575945 polymorphism of the annexin-A5 gene is associated with schizophrenia, and its minor allele is responsible for higher levels of the annexin-A5 protein in the blood and represent one of the risk factors for this disease PMID: 24466757
  49. ANXA5 M2 haplotpye appears as an recurrent pregnany loss risk factor in male and female carriers with most distinguishable effects between the 10th and 15th week of gestation. PMID: 23899942
  50. It appears that the haplotype M2/ANXA5 is not associated with the presence of anti-trophoblast antibodies. PMID: 23529182
  51. M2/ANXA5 seems an independent recurrent pregnancy loss risk factor in Polycystic Ovary Syndrome patients PMID: 23498654
  52. The dynamic detection of concentration of annexin-5 can ameliorate the prognosis of possibility of development of cardio-vascular complications under diseases of kidneys. PMID: 23984545
  53. Elevated plasma AnxA5 level in patients after atrial switch operation is associated with impaired systemic myocardial deformation, increased subpulmonary ventricular eccentricity, and increased serum TNF-alpha level. PMID: 23284897
  54. study confirms the presence of both endothelial dysfunction and subclinical atherosclerosis in SLE patients and suggests serum annexin A5 as predictive biomarker for subclinical atherosclerosis in SLE patients. PMID: 23724626
  55. double and opposite role of annexin A5 in regulating the endocytic and autophagic pathways and the fusion of autophagosomes with lysosomes and endosomes PMID: 22266906
  56. The Annexin A5 -1C/T polymorphism may be involved in the development of coal worker's pneumoconiosis in Han Chinese coal miners. PMID: 22804929
  57. Annexin V expression in the decidua tissues was significantly different between normal pregnancy group and early or late onset severe preeclampsia group. PMID: 19620076
  58. Annexin A5 homodimer diannexin binds to phosphatidylserine with high affinity and is a potent inhibitor of platelet-mediated events during thrombus formation. PMID: 22463102
  59. SA-ANX5 as a new biomarker for cellular aging and implicate a functional role for annexin A5 in cellular senescence. PMID: 22728018
  60. the heterogeneous transcellular distribution, increased intracellular concentrations and decreased serum levels of AnxA5 represent a protective response to lupus-related thrombophilia; AnxA5 mostly participate in the common coagulation pathway in the thrombogenesis of SLE. PMID: 22425772
  61. A role has been determined for ANXA5 and the M2 haplotype in the fetus and/or the extraembryonic membranes for pregnancy pathology. PMID: 22624674
  62. M2/ANXA5 haplotype associated with antiphospholipid antibodies [review] PMID: 22635237
  63. Report association between plasma ANX A5 and anti-annexin antibody levels and severity of systemic lupus erythematosus. PMID: 21298269
  64. AnxA5 SNPs could serve as markers for restenosis after PCI and AnxA5 therapeutically prevents vascular remodeling in a dose-dependent fashion in mice. PMID: 22341596
  65. Increased levels of annexin-V and decreased levels of TNF-alpha are the result of stabilization via chronic treatment of schizophrenia. PMID: 21741441
  66. Children and adolescents with rheumatic diseases and persistent antiphospholipid antibodies have reduced annexin A5 anticoagulant activity, whereas transient, nonpathogenic antiphospholipid antibody levels have less effect on annexin A5 activity. PMID: 22174207
  67. Annexin V promotes anticoagulant activity via inhibition of prothrombin activation in patients with acute cerebral ischemia; anti- annexin V IgG is associated with stroke events. PMID: 21450308
  68. Annexin V played an important role in the pathogenesis and progression of preeclampsia by affecting coagulation. PMID: 21426764
  69. Findings support the hypothesis that genomic variations within the ANXA5 gene upstream region impact upon the disease susceptibility to recurrent pregnancy loss . PMID: 21289001
  70. Data show that annexin A5 autoantibodies from patients produced a significant disruption of incomplete annexin A5 crystalline shield on phospholipid bilayer. PMID: 21185149
  71. The anxA5 variants with impaired internalization are superior molecular imaging agents in pretargeting strategies as compared with wild-type anxA5. PMID: 21078669
  72. The M2 allele of ANXA5 can be linked to reduced mRNA levels in heterozygous placentas and could result in more confined protein levels (lowered expression dynamics) of annexin A5. PMID: 20805002
  73. annexin A5 has multiple effects on CFTR, so that the net effect observed is cell system-dependent PMID: 21067452
  74. Cardiac resynchronization therapy-induced LV reverse remodelling is associated with reduction in plasma AnxA5. The excess of AnxA5 is detrimental for HL-1 cardiomyocytes. PMID: 20542876
  75. Lp(a) interferes with annexin A5 binding to the procoagulant phosphatidylserine which translocates to the membrane surface under stress condition PMID: 20705065
  76. The M2 haplotype within the ANXA5 gene may represent a new thrombophilic risk factor for pregnancy-related venous thromboembolism PMID: 20643388
  77. gene polymorphism is associated with deep venous thrombosis PMID: 20174767
  78. ANXA5 expression seems to be related to the tumor stage and clinical outcome of colorectal adenocarcinoma. Thus ANXA5 could serve as a prognostic marker for tumor progression. PMID: 19461527
  79. Annexin V expression in apoptotic peripheral blood lymphocytes: an electron microscopic evaluation PMID: 11773704
  80. In vivo imaging of acute cardiac rejection in human patients using (99m)technetium labeled compound. PMID: 12102261
  81. A common polymorphism in the annexin V Kozak sequence (-1C>T) increases translation efficiency and plasma levels of annexin V, and decreases the risk of myocardial infarction in young patients. PMID: 12200370
  82. The -1C>T mutation in this gene does not afffect plama levels of this protein PMID: 12732504
  83. CR2-positive cells undergo apoptosis; the unmasking of Annexin V binding sites resembles the unmasking of CR2. Therefore, apoptotic cells from the same lineage may share a similar mechanism for neo-surface markers. PMID: 12798778
  84. displacement of annexin A5 from cellular surfaces by antiphospholipid antibodies is not a common mechanism in patients with antiphospholipid antibodies PMID: 12871462
  85. IGF-I activates specific apoptotic pathways (Caspase-3 activation, Annexin-V binding and DNA degradation in an osteosarcoma cell line. PMID: 14710359
  86. a massive number of circulating annexin-V-binding neutrophils in the absence of apoptosis can be demonstrated in BTHS. These neutrophils expose an alternative substrate for annexin-V different from PS and not recognized by macrophages. PMID: 14764526
  87. annexin V regulates coagulability in the blood stream by binding not only to phosphatidylserine but also to sulfatide PMID: 15173196
  88. plasmas from patients with aPL antibodies with thromboembolism reduce both A5 binding to phospholipid and A5 anticoagulant activity, identifying a novel mechanism for thrombosis in the aPL syndrome. PMID: 15242878
  89. B-helix calcium binding sites have an essential role in the membrane binding of annexin V PMID: 15280367
  90. In mature sperm, caspase activation was only detected in annexin V fraction. Selection of annexin V-negative mature spermatozoa might be of relevance for fertility preservation, as this fraction shows no activated apoptosis during cryopreservation. PMID: 15286043
  91. phosphatidylserine-annexin A5-mediated pinocytic pathway PMID: 15381697
  92. analysis of Annexin A5-1C/T polymorphism in ischemic stroke PMID: 15634283
  93. CRP and annexin A5 at physiological concentrations bind to distinct sites of negatively charged phospholipids present in oxidized LDL PMID: 15692104
  94. The -1C to T polymorphism in the annexin A5 gene is not associated with the risk of acute myocardial infarction or sudden cardiac death in middle-aged Finnish males. PMID: 16025836
  95. Reduction of annexin A5 and interference with its anticoagulant and binding activities are associated significantly with history of recurrent spontaneous pregnancy losses. Possible significant role for annexin A5 in maintenance of pregnancy. PMID: 16389029
  96. AnxA5 is present in amniotic fluid and increases through gestation from 15 to 24 weeks. Elevated AF-AnxA5 levels were present in patients who developed intrauterine growth restriction. PMID: 16579937
  97. Through an inducible association with the R2 subunit of the IFN-gamma receptor, annexin 5 modulates cellular responses to IFN-gamma by modulating signaling through the Jak-Stat1 pathway. PMID: 16670301
  98. The -1T variant of the annexin V gene, which has been suggested to have a protective role against thrombotic disease, was evaluated in 140 women with pregnancy complications and 317 control women with uncomplicated pregnancies. PMID: 16704958
  99. following cell activation, deltaPKC-annexin V binding is a transient and an essential step in the function of deltaPKC PMID: 16785226
  100. Plasmas with beta2GPI-dependent LAC that recognize domain I displayed significantly increased AnxA5 resistance, suggesting that specifically anti-beta2GPI antibodies compete with AnxA5 for anionic phospholipids PMID: 17053060

Show More

Hide All

Involvement in disease Pregnancy loss, recurrent, 3 (RPRGL3)
Protein Families Annexin family
Database Links

HGNC: 543

OMIM: 131230

KEGG: hsa:308

STRING: 9606.ENSP00000296511

UniGene: Hs.480653

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1