Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Cardiovascular
Alternative Names
Anchorin CII; Annexin 5; Annexin A5; Annexin V; Annexin-5; Annexin5; AnnexinA5; AnnexinV; ANX 5; ANX A5; ANX5; ANXA5; ANXA5_HUMAN; Calphobindin I; CBP-I; Endonexin II; ENX 2; ENX2; Lipocortin V; PAP I; PAP-I; Placental anticoagulant protein 4; Placental anticoagulant protein I; PLACENTAL PROTEIN 4; PP 4; Pp4; RPRGL3; Thromboplastin inhibitor; VAC-alpha; Vascular anticoagulant-alpha
Species
Homo sapiens (Human)
Expression Region
2-320aa
Target Protein Sequence
AQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant Human ANXA5 was expressed with the amino acid range of 2-320. The theoretical molecular weight of the ANXA5 protein is 37.8 kDa. This protein is generated in a yeast-based system. The ANXA5 gene fragment has been modified by fusing the N-terminal 6xHis tag, providing convenience in detecting and purifying the recombinant ANXA5 protein during the following stages.
The human Annexin A5 (ANXA5) is a cellular protein belonging to the annexin family, known for its calcium-dependent phospholipid-binding properties. ANXA5 plays a role in several cellular processes, including membrane trafficking, vesicle formation, and apoptosis regulation. ANXA5 has a unique ability to bind to phospholipids in a calcium-dependent manner, which can influence membrane structure and function. Additionally, ANXA5 has anti-coagulant properties and is used in clinical settings as a marker for apoptosis due to its ability to bind to phosphatidylserine exposed on the outer leaflet of apoptotic cell membranes. Research on ANXA5 extends to its involvement in various physiological and pathological processes, including blood clotting, immune response, and cancer.