Recombinant Human Annexin A5(ANXA5)

In Stock
Code CSB-YP001846HU
Product Type Recombinant Protein
Size US$2959Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P08758
Lead Time 3-7 business days
Relevance This protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Anchorin CII;Annexin V;Annexin-5;Calphobindin I ;CBP-IEndonexin II;Lipocortin V;Placental anticoagulant protein 4 ;PP4Placental anticoagulant protein I ;PAP-I;Thromboplastin inhibitor;Vascular anticoagulant-alpha ;VAC-alpha
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence AQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD
Research Area Cardiovascular
Source Yeast
Gene Names ANXA5
Protein Names Recommended name: Annexin A5 Alternative name(s): Anchorin CII Annexin V Annexin-5 Calphobindin I Short name= CBP-I Endonexin II Lipocortin V Placental anticoagulant protein 4 Short name= PP4 Placental ant
Expression Region 2-320aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 37.8kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function This protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade.
Involvement in disease Pregnancy loss, recurrent, 3 (RPRGL3)
Protein Families Annexin family
Database Links

HGNC: 543

OMIM: 131230

KEGG: hsa:308

STRING: 9606.ENSP00000296511

UniGene: Hs.480653

Related Products

ANXA5 Antibodies

ANXA5 Antibodies for Human

ANXA5 Antibodies for Homo sapiens (Human)

ANXA5 Proteins

ANXA5 Proteins for Homo sapiens (Human)

ANXA5 ELISA Kit

ANXA5 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.