Recombinant Human Apolipoprotein A-II (APOA2)

In Stock
Code CSB-EP001915HU
Abbreviation Recombinant Human APOA2 protein
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cancer
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
24-100aa
Target Protein Sequence
QAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
21.7 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May stabilize HDL (high density lipoprotein) structure by its association with lipids, and affect the HDL metabolism.
Gene References into Functions
  1. Weight loss resulted from a reduction of HDL in both APOE-II genotypes. However, in C homozygote carriers, it was shown that HDL3 reduced significantly and leads to a general shift toward larger size HDL subfractions after intervention, while in T allele carriers HDL2 decreased significantly and weight loss leads to shift toward smaller size HDL subfractions. PMID: 28545455
  2. There was a statistically significant interaction between APOA2 polymorphism and dietary fatty acids intake on oxidative stress n patients with type 2 diabetes PMID: 27271094
  3. This study detected a reduced level of heterodimer apoA2-ATQ/AT and a specific apoA2 isoform hypo-processing pattern in the sera of autoimmune pancreatitis patients. PMID: 29481802
  4. In type 2 diabetes mellitus patients, the dietary intake of antiinflammatory fatty acids, such as omega-3 PUFAs and MUFAs, could reduce the inflammatory effects associated with the Apolipoprotein A2 CC genotype. In addition, proinflammatory fatty acids, such as SFAs, could overcome the antiinflammatory effect of the T-allele. PMID: 28359369
  5. data support an SR-B1 nibbling mechanism that is similar to that of streptococcal serum opacity factor, which also selectively removes CE and releases apoAI, leaving an apoAII-rich remnant. PMID: 28373285
  6. A new missense mutation in an Iranian population has a significant association with high-density lipoprotein cholesterol levels. PMID: 26590203
  7. ApoAII-ATQ/AT not only distinguished the early stages of pancreatic cancer from healthy controls but also identified patients at high risk for pancreatic malignancy. PMID: 26549697
  8. Plasma apoB pool size of VLDL containing apoA-II is much smaller than that of VLDL without apoA-II, and this was caused by a very low rate of secretion of this VLDL type into plasma. PMID: 26071654
  9. APOA-II polymorphism and oxidative stress is associated with poor prognosis in patients with type 2 diabetes. PMID: 26104730
  10. Apolipoprotein AII was detected as a protein associated with the urinary protein/urinary creatinine levels in pediatric idiopathic steroid-sensitive nephrotic syndrome PMID: 24633472
  11. Apolipoprotein A-II/B significantly improves risk prediction of overall survival, also in carotid surgery patients with lower LDL levels PMID: 25953375
  12. Apolipoprotein A-II and the regulation of high density lipoproteins in cardiovascular disease. [Review] PMID: 24012775
  13. We have cloned the cDNA encoding human ApoA-II and achieved its high-level secreting expression with a yield of 65 mg/L of yeast culture PMID: 24116940
  14. identified a statistically significant interaction between the APOA2 -265T > C variant and higher-fat dairy food intake in the Boston Puerto Ricans and replicated this relation in the GOLDN study PMID: 24108135
  15. Clinical studies demonstrate that apoA-II is a strong predictor of risk for CVD. There is no evidence, however, that selective therapeutic modification of apoA-II impacts on atherosclerosis and clinical outcomes.[review] PMID: 21501035
  16. These data suggest Apo-AII-containing high-density lipoproteins (HDL) formed intrahepatically are likely cholesterol-rich compared to the smaller intracellular lipid-poor Apo A-I HDL. PMID: 23025327
  17. Enrichment of apo A-II in high-density lipoprotein particles has atheroprotective effects and apo A-II may become a target for the treatment of atherosclerosis. PMID: 23241412
  18. We conclude that apoA-II plays a significant role in apoE-associated risk of incident CVD in women with high levels of HDL-C and CRP. PMID: 22723940
  19. APOA2 m265 genotype may be associated with eating behaviours and dietary modulation of plasma ghrelin. PMID: 21386805
  20. a gene-diet interaction involving the APOA2 -265T>C SNP and saturated fat intake determines body weight in a Mediterranean and an Asian populations PMID: 20975728
  21. Human apolipoprotein A-II inhibits the production of interferon-gamma by concanavalin A-stimulated mouse and human CD4-positive T cells. PMID: 21300819
  22. Low apolipoprotein-A2 is associated with metastatic renal cell cancer. PMID: 20022911
  23. ApoA-II plays a crucial role in triglyceride catabolism by regulating lipoprotein lipase activity, at least in part, through HDL proteome modulation. PMID: 19910634
  24. The serum apoA-II concentrations confer risk for MetS and diabetes and exhibit evidence of anti-inflammatory properties among Turks. PMID: 19817643
  25. In metabolic syndrome, fenofibrate, but not atorvastatin, influences high density lipoprotein metabolism by increasing the transport of APOA2 particles. PMID: 19651918
  26. when expressed in transgenic mice, HDL shows antioxidant properties PMID: 11971944
  27. Overexpression in transgenic mice does not increase their susceptibility to insulin resistance and obesity PMID: 12032642
  28. Evaluated as a positional candidate gene for familial Type II diabetes, altered lipid concentrations, and insulin resistance PMID: 12136402
  29. Crystallographic studies of apo A-II and its complex with lipid surrogate beta-octyl glucoside show that disulfide-linked dimers of apo A-II form amphipathic alpha-helices which aggregate into tetramers. PMID: 12269810
  30. Carriers of a novel splice-site mutation in the LDL-receptor gene were simultaneously homozygous for the -265C variant of apoA-II thus concluding that one variant of the apoA-II gene was associated with reduced plasma LDL cholesterol in FH patients PMID: 12522687
  31. This protein inhibits high density lipoprotein remodeling and lipid-poor apolipoprotein A-I formation PMID: 12690114
  32. Genetic association of plasma apolipoprotein A-II levels with familial combined hyperlipidemia. PMID: 12738753
  33. Analysis of trancription factors that bind response elements in the apoA-II promotor and modulate transcription. PMID: 12959642
  34. apoA-II affects both the structure and the dynamic behavior of HDL particles and selectively modifies lipid metabolism PMID: 14967812
  35. In transgenic mice overexpressing the human apoA-II gene, plasma human apoA-II concentration was positively correlated with blood glucose levels. PMID: 14988251
  36. this protein-exonic splicing enhancer interaction is able to promote the incorporation of exon 3 in mRNA and suggest that they can rescue the splicing despite the noncanonical 3' splice site. PMID: 15247216
  37. Overexpressed human apoA-II in mice impairs HDL protection of apoB-lipoproteins from oxidation. Displacement of PON1 by apoA-II may explain why PON1 is found in HDL particles with apoA-I, not apoA-II, & apo-A-II-rich HDL's poor antiatherogenic properties. PMID: 15388641
  38. results indicate a significant association between the T265C APOA-II polymorphism and levels of visceral adipose tissue in premenopausal women present in white but not African-American women PMID: 15833935
  39. Characterization of regulatory elements found in the apoA-II exon 3 and its flanking introns that are involved in the control of apoA-II exon 3 splicing. PMID: 16254078
  40. the association of apoA-II with triglyceride-rich lipoproteins occurs in the circulation and induces postprandial hypertriglyceridemia PMID: 16990646
  41. ApoA-II adopts a beltlike structure in which the protein helices wrap around the lipid- bilayer reconstituted high density lipoprotein (rHDL) disc. PMID: 17264082
  42. ApoAII is efficiently reabsorbed in kidney proximal tubules in relation to its plasma concentration PMID: 17652309
  43. carriers of the minor allele for Apo A-II -265T/C (CC/TC) have a lower postprandial response compared with TT homozygotes PMID: 17709437
  44. ApoA-II is associated with a decreased risk of future coronary artery disease in apparently healthy people, implying that apoA-II itself exerts effects on specific antiatherogenic pathways. PMID: 17923573
  45. APOAII rs5082 polymorphism may have a role in reducing risk of coronary artery disease in an Australian male population PMID: 18179799
  46. results for dimeric apolipoprotein AII are similar to those we have reported for the monomeric apolipoprotein CI, which has a similar secondary structure but a different peptide sequence and net charge PMID: 18652418
  47. procoagulant activities of plasma factor VIIc and factor Xc are positively and independently associated with concentrations of the high-density lipoprotein apolipoprotein, apo A-II PMID: 18766253
  48. small sizes (i. e., number of kringle-4 repeats in the gene) of apolipoprotein (a) are risk factors for the development of atherothrombosis. (review) PMID: 19069164
  49. Results indicate that CETP inhibition increases plasma concentrations of apoA-II by delaying HDL apoA-II catabolism and significantly alters the remodeling of apoA-II-containing HDL subpopulations. PMID: 19193611
  50. The available data does not support a role for common variants in APOA2 on type 2 diabetes susceptibility or related quantitative traits in Northern Europeans PMID: 19216768

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Apolipoprotein A2 family
Tissue Specificity
Plasma; synthesized in the liver and intestine.
Database Links

HGNC: 601

OMIM: 107670

KEGG: hsa:336

STRING: 9606.ENSP00000356969

UniGene: Hs.237658

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*