Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
AQP 4; AQP-4; AQP4; AQP4_HUMAN; Aquaporin type 4; Aquaporin-4; Aquaporin4; HMIWC 2; HMIWC2; Mercurial insensitive water channel; Mercurial-insensitive water channel; MGC22454; MIWC; WCH 4; WCH4
Species
Homo sapiens (Human)
Expression Region
253-323aa
Target Protein Sequence
CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Cytoplasmic Domain
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant human AQP4 protein is a fusion protein consists of the human AQP4 protein (253-323aa) partnered with the N-terminal 6xHis-SUMO tag. It was produced in the E.coli. This recombinant AQP4 protein's purity is greater than 90% determined by SDS-PAGE. After electrophoresis, there is a 22 kDa protein band presented on the gel.
Aquaporin 4 (AQP4) is one of the three types of aquaporins (AQPs) that have been described in astrocytes. AQP4 protein is the predominant aquaporin found in brain and has an important role in brain water homeostasis. Its expression is mainly confined to astrocytes, but its distribution and levels of expression vary between different brain regions. In the cerebral cortex, AQP4 expression is particularly abundant in astrocytes aligning blood vessels. Recent researches found the correlations of AQP4 expression and polymorphism with diabetic retinopathy. Upregulation of aqp4 improves blood–brain barrier integrity and perihematomal edema following intracerebral hemorrhage. One findings suggested that anti-AQP4 autoantibodies promote ATP release from astrocytes and induce mechanical pain in rats. Nevertheless, the predominant pattern of AQP4 in the central nervous system is highly polarized, especially in astrocytes in the proximity of or in contact with blood vessels, the ependymal layer, and pia.