Recombinant Human Atrial natriuretic peptide receptor 3 (NPR3), partial

In Stock
Code CSB-EP016025HU2
Abbreviation Recombinant Human NPR3 protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Others
Alternative Names
Atrial natriuretic peptide receptor 3; Atrial natriuretic peptide clearance receptor; Atrial natriuretic peptide receptor type C (ANP-C; ANPR-C; NPR-C)
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
36-127aa
Target Protein Sequence
AGIGGGRQEREALPPQKIEVLVLLPQDDSYLFSLTRVRPAIEYALRSVEGNGTGRRLLPPGTRFQVAYEDSDCGNRALFSLVDRVAAARGAK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
41.5 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for the natriuretic peptide hormones, binding with similar affinities atrial natriuretic peptide NPPA/ANP, brain natriuretic peptide NPPB/BNP, and C-type natriuretic peptide NPPC/CNP. May function as a clearance receptor for NPPA, NPPB and NPPC, regulating their local concentrations and effects. May regulate diuresis, blood pressure and skeletal development. Does not have guanylate cyclase activity.
Gene References into Functions
  1. NPR3 expression is downregulated by MRCCAT1 in the in metastatic clear cell renal cell carcinoma. PMID: 28659173
  2. This study suggested that NPR3 rs2270915 polymorphism was associated with decreased systolic blood pressure level marginally in essential hypertension patients in a Chinese Han population; the polymorphism may function through decreasing NPR3 mRNA expression and ANP level. PMID: 28497617
  3. NPR-C gene single nucleotide polymorphisms significantly contribute to CAD susceptibility in the Chinese Han population PMID: 27191271
  4. The NPRC genetic variant,Rs1847018, is a genetic marker of essential hypertension. PMID: 26782497
  5. This study focused on the natriuretic peptide receptor C gene (NPR3). The correlation analysis between NPR3 and hypertension was replicated in 450 Chinese Dai and 484 Chinese Mongolian individuals. PMID: 26345810
  6. Angiotensin II downregulates vascular smooth muscle cell NPR-C gene expression by destabilizing its mRNA. PMID: 25711724
  7. Results from this study point to a role for miR-100 in the regulation of NPR3 expression, and suggest a possible therapeutic target for modulation of NP bioactivity in heart disease. PMID: 25736855
  8. Data show that natriuretic peptide receptor 3 (NPR3) single nucleotide polymorphism (SNP) is independently associated with diastolic dysfunction and does not appear to be related to alterations in circulating levels of natriuretic peptides. PMID: 24465655
  9. The significant change in NPR3 protein was observed for the Arg146 variant allozyme, with 20% of wild-type protein, primarily because of autophagy-dependent degradation. PMID: 23493048
  10. polymorphisms or haplotype in NPR3 gene may influence the risk of ischemic stroke or hypertension independently in Chinese population. PMID: 22559095
  11. a NPR3 promoter gene variant could have a role on cerebrovascular disease susceptibility PMID: 22995222
  12. Report the presence of CNP and its receptors, NPR2/3 in atherosclerotic plaques of human carotid artery, with increased expression of NPR3 in histologically unstable plaques. PMID: 22421372
  13. Data found a consistent and significant association between the rs2270915 polymorphism of the NPR3 gene and SBP in diabetic patients. This genetic variation may affect pressure response to changes in dietary sodium. PMID: 21464461
  14. integrative genomics approach to a large cohort of medulloblastomas has identified four disparate subgroups (NPR3)with distinct demographics, clinical presentation, transcriptional profiles, genetic abnormalities, and clinical outcome. PMID: 20823417
  15. The mRNA levels of natriuretic peptide receptor-C appear to be increased in epicardial adipose tissue independent of their plasma levels in coronary artery disease. PMID: 20691218
  16. The novel Npr1 gene 3C variant and the Npr3 gene C(-55) allele are associated with hypertensive family history. PMID: 12872042
  17. Atrial natriuretic paptide, purified from medium bathing cells expressing NPR-C, a receptor known to internalize natriuretic peptides, was degraded. PMID: 15459247
  18. Novel six-nucleotide repeat polymorphism located 4 base pairs upstream of the major transcriptional initiation site. PMID: 15785005
  19. model of hormone recognition and allosteric receptor activation revealed from structural studies of NPR-C [review] PMID: 15911071
  20. discussion of NPR-C receptor coupling to different signaling pathways and their regulation [review] PMID: 15911072
  21. A structural comparison of complexes of NPC-C with each NP hormones (ANP, BNP, and CNP)reveals that NPR-C uses a conformationally inflexible surface to bind three different, highly flexible, NP ligands. PMID: 16870210
  22. The NPRC polymorphism is not an independent determinant of NP concentration in HF. PMID: 17890443
  23. the NPR-C receptor is expressed in normal and neoplastic human alpha cells. PMID: 19352691

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Protein Families
ANF receptor family
Database Links

HGNC: 7945

OMIM: 108962

KEGG: hsa:4883

STRING: 9606.ENSP00000265074

UniGene: Hs.13528

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*