Recombinant Human BH3-like motif-containing cell death inducer (BLID)

Code CSB-EP818276HU
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
BLID
Uniprot No.
Research Area
Cell Biology
Alternative Names
BH3-like motif containing; cell death inducer; BH3-like motif-containing cell death inducer; BLID; BLID_HUMAN; BRCC2; breast cancer cell 2; Breast cancer cell protein 2
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-108aa
Target Protein Sequence
MVTLLPIEGQEIHFFEILESECVLYTGWIERASGSSIYPEAKARLPLEALLGSNKEPMLPKETVLSLKRYNLGSSAMKRNVPGHVLQRPSYLTRIQVTLLCNSSAEAL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
39.0kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Functions as a proapoptotic molecule through the caspase-dependent mitochondrial pathway of cell death.
Gene References into Functions
  1. Results showed that the expression of BLID is frequently downregulated in non-small cell lung tumors and cell lines and inversely correlates with miR-575 expression. PMID: 25728273
  2. loss of BLID may contribute to the progression of intraductal proliferation lesions to breast cancer. PMID: 24532431
  3. BRCC2 functions as a novel tumor suppressor in breast cancer and may be a potential therapeutic target for breast cancer management. PMID: 23928696
  4. Frequent loss of the BLID gene is observed in early-onset breast cancer. PMID: 21846966
  5. Tag single nucleotide polymorphisms near the BLID and LOC399959 genes are not susceptibility loci for high myopia in the Chinese Han population. PMID: 21031016
  6. BLID upregulation resulting from a novel IGH translocation is associated with childhood B-Cell precursor acute lymphoblastic leukemia. PMID: 20544842
  7. BLID is a new binding partner of Bcl-X(L) and a significant prognostic factor in breast cancer PMID: 20400521
  8. BRCC2 is a novel BH3-like domain-containing protein which induces apoptosis in a caspase-dependent manner PMID: 15069058
  9. BLID gene is assigned to 11p24.1. PMID: 18940476
  10. Observational study and genome-wide association study of gene-disease association. (HuGE Navigator) PMID: 19779542

Show More

Hide All

Subcellular Location
Cytoplasm. Mitochondrion. Note=Lower abundance in mitochondrion than in cytoplasm.
Tissue Specificity
Ubiquitously expressed.
Database Links

HGNC: 33495

OMIM: 608853

KEGG: hsa:414899

STRING: 9606.ENSP00000453153

UniGene: Hs.686109

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*