Recombinant Human Beta-3 adrenergic receptor (ADRB3), partial

In Stock
Code CSB-EP001393HU2
Abbreviation Recombinant Human ADRB3 protein, partial
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cardiovascular
Alternative Names
Beta-3 adrenoreceptor
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
345-408aa
Target Protein Sequence
IYCRSPDFRSAFRRLLCRCGRRLPPEPCAAARPALFPSGVPAARSSPAQPRLCQRLDGASWGVS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
38.6 kDa
Protein Length
Partial
Tag Info
C-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. Beta-3 is involved in the regulation of lipolysis and thermogenesis.
Gene References into Functions
  1. results of this study have shown a significant association between the Trp64Arg polymorphism in ADRB3 gene and the development of overweight and obesity in Saudi populations; It also has an influence on the levels of lipid, insulin, leptin, and glucose PMID: 29587766
  2. the association between the Arg64 allele of the Trp64Arg polymorphism of ADRB3 gene, FATMAX, and LDL-cholesterol levels should be interpreted with caution, as it may represent a small portion of complex physiological processes related to lipolysis and metabolism lipids. PMID: 28941386
  3. Nerve fibers expressing immunoreactivity for beta3AR were abundantly found in the mucosa and muscular layers of the human bladder. PMID: 28185314
  4. The presence of the Trp64Trp genotype is related to higher TAG level in CTDs and reliably predicts hypertriglyceridemia. PMID: 29606859
  5. The current meta-analysis demonstrated that Trp64Arg polymorphism in ADRB3 was associated with sus- ceptibility to GDM in the European Caucasian population. PMID: 28783993
  6. The mechanism(s) of downstream beta3 adrenoceptor activation in human corpus cavernosum and in penile artery involves CSE-derived H2S and cGMP elevation. In other words, beta3 relaxation does not need the endothelium but is still able to amplify the cGMP signaling through H2S pathway. This study defines a possible novel pharmacological approach in erectile dysfunction treatment. PMID: 28760490
  7. There were no differences between the distribution of genotypes and the allele frequencies of the PPARG Pro12Ala, and C1431T polymorphisms and the ADRB3 Trp64Arg polymorphism in normo- and hyperglycaemic women. PMID: 29464546
  8. the mechanism of beta3-AR-mediated upregulation of hepatic apoA-I expression PMID: 28802864
  9. ADRB3 gene Trp64Arg mutation was significantly associated with an increased predisposition toward hypertension and elevated systolic/diastolic BP in hypertensive patients, suggesting that Trp64Arg is an important hypertension-susceptibility marker. PMID: 28404887
  10. Studied weight loss in obese patients with Perilipin 4 (PLIN4), Fat mass and obesity-associated (FTO), and beta- adrenergic receptor 3 (ADRB3) polymorphisms treated with Garcinia cambogia/Glucomannan. Results suggest weight loss was attenuated in carriers of PLIN4, FTO, ADRB3 polymorphisms. PMID: 29361938
  11. Middle-age adult Asians with the ADRB3 rs4994 minor alleles are at increased risk of Type 2 Diabetes (Meta-Analysis). PMID: 28521197
  12. It has been shown, that presence of one mutant allele of rs9939609 (gene FTO) and rs4994 (gene ADRB3) leads to statistically significant association with obesity. PMID: 29381017
  13. In mutant group of beta3 adrenoreceptor gene patients have higher insulin and HOMA levels than wild type group, without relation with metabolic PMID: 28421794
  14. Pharmacological experiments allowed us to demonstrate that these effects were driven by an Erk1/2-mediated activation of the antioxidant transcription factor PPARg. These results suggest that b3-AR protective effects in the myometrium could be due to its dual antioxidant properties. PMID: 28723418
  15. body mass index (BMI) >/=25, PRRs of beta-3 adrenergic receptor genotype (Trp/Arg and Arg/Arg) for periodontal disease markers were 0.13 to 0.70, those of PPARgamma genotype (Pro/Pro) were 0.66 to 3.14 and those of the interaction term for the two genotypes were 1.69 to 12.61. Results confirm a positive relation between beta-3 adrenergic receptor genotype & PPAR-gamma genotype PMID: 25855572
  16. Study reports association of the Arg64 allele of the rs4994 polymorphism of ADRB3 with increased serum urate in Western Polynesian individuals. PMID: 26410617
  17. ADRB3 expression correlated strongly with overactive bladder related symptoms. PMID: 26617941
  18. our result suggested complex interactions amongst the studied SNPs and ADRB3 rs4994 as candidate influencing GBC susceptibility. PMID: 26602921
  19. A non-significant association between total body fat (TBF) and B3Trp64Arg persisted among sedentary controls only when intervention groups were separated (%TBF gain with B3Arg64+ carriage, p = 0.03); exercisers lost TBF regardless of genotype. PMID: 20401689
  20. Study tested the association of peroxisome proliferator-activated receptor and beta3-AR polymorphisms with metabolic, nutritional, and blood pressure parameters in 271 postmenopausal women PMID: 25827163
  21. Trp64Arg polymorphism associated with elevated lipid and apolipoprotein levels in Chinese population PMID: 25928572
  22. W64R Polymorphism in the adrenergic beta-3- receptor is not associated with obesity and waist-to-hip ratio. PMID: 25800470
  23. Meta-analysis: Trp64Arg polymorphism in the beta3-AR gene is involved in the pathogenesis of overactive bladder. PMID: 25867395
  24. Carriers of the ADRB3 Arg64 allele had a significantly higher relative body weight and relative body mass index compared with non-carriers. PMID: 25081806
  25. Genetic association of ADRB3 single nucleotide polymorphism with metabolic syndrome among the Tatars PMID: 26410938
  26. Arg64 associated with decreased response to reactive hyperemia in the brachial artery PMID: 24670327
  27. in the codominant model Trp/Arg genotype, there was an odds ratio or 1.67 which was increased to 2.56 for the Arg/Arg genotype for association with type 2 diabetes PMID: 24972470
  28. No significant differences in lipolysis or lipid oxidation were observed between 64R and 64W allele carriers of ADRB3 at any time during the aerobic load. PMID: 24905907
  29. T190C variation of the beta3-AR gene was not associated with increased risk for chronic heart failure PMID: 25636111
  30. Aromatic residues in adrenergic beta-3 receptor play an important role in the function of the receptor. PMID: 22728712
  31. genetic polymorphism determines relationship between childhood obesity and asthma in Taiwan PMID: 24786241
  32. Higher levels of cardiorespiratory fitness may attenuate the risk of atherosclerosis associated with ADRB3 Trp64Arg polymorphism. PMID: 24658877
  33. results demonstrate that the activation of beta3-adrenoceptors inhibits neurogenic contractions ofboth rat and human urinary bladder. PMID: 24378642
  34. study indicates a positive association between periodontal disease and the beta-3 adrenergic receptor genotype in obese individuals. PMID: 24460850
  35. This study shows that the Trp64Arg polymorphism in the beta3-AR gene is weakly but significantly associated with overactive bladder syndrome PMID: 24038238
  36. Results suggest that epigenetic changes at the ADRB3 gene locus might be involved in the development of obesity and its related metabolic complications. PMID: 24579945
  37. UCP1 -3826A/G and ADRB3 Trp64Arg polymorphisms may have a combined effect in the modulation of overweight/obesity and HDL-C levels in type 2 diabetes mellitus (T2DM) Caucasian-Brazilian patients PMID: 24138564
  38. The results of these studies suggest that genetic variants of the FTO gene rs9939609 genotype and Trp64Arg ADRB3 contribute to the development of obesity among residents of Moscow and Sverdlovsk Region of Russia. PMID: 25059067
  39. Suggest that ADRB3 C190T may be involved in the complex pathophysiology of coronary artery disease. PMID: 24201118
  40. Genetic polymorphisms of ADRB3, FTO, and UCP2 genes are associated with overweight in athletes of winter sports. PMID: 24741957
  41. beta3-ARs are expressed in B16F10 melanoma cells. beta3-ARs are involved in B16F10 cell proliferation and apoptosis. Reduced beta3-AR function decreases the growth of melanoma induced by B16F10 cell inoculation PMID: 23907236
  42. Trp64Arg polymorphism was associated with hyperuricemia in a Chinese male population and should be an independent risk factor for hyperuricemia PMID: 23729572
  43. ADRb3 T190C polymorphism is significantly associated with Gallbladder cancer and gallstone disease susceptibility. PMID: 24556804
  44. Human ureteral relaxation is mediated by both beta(2) - and beta(3) -adrenoceptor stimulation. beta(3) -Adrenoceptor agonists have the potential to relax the human ureter, and their clinical application in the treatment of ureteral stones is expected. PMID: 23360304
  45. Enhanced expression of beta3-adrenoceptors in cardiac myocytes attenuates neurohormone-induced hypertrophic remodeling through nitric oxide synthase. PMID: 24190960
  46. The study signifies that the Arg64 allele of the ADRB3 gene is a genotypic risk factor and confers susceptibility to type 2 diabetes PMID: 23968135
  47. beta3AR 64 Trp/Arg substitution accelerates age-related decrease in BAT activity, and thereby may associate with visceral fat accumulation with age. PMID: 23032405
  48. In a study population of young adult Japanese males, the impact of the Trp64Arg polymorphism on the association between exercise and body composition was weak, if it existed at all. PMID: 23292548
  49. study found disease risk factors in postmenopausal women are not directly associated with the polymorphisms of peroxisome proliferator-activated receptor gamma 2 and adrenoceptor beta 3 genes PMID: 23113754
  50. Trp64Arg variant of ADRB3 was associated with body mass index in East Asians, but not Europeans PMID: 21358132

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRB3 sub-subfamily
Tissue Specificity
Expressed mainly in adipose tissues.
Database Links

HGNC: 288

OMIM: 109691

KEGG: hsa:155

STRING: 9606.ENSP00000343782

UniGene: Hs.2549

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*