Recombinant Human Beta-defensin 4A (DEFB4A)

Code CSB-EP006705HU(A4)
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
DEFB4A
Uniprot No.
Alternative Names
BD 2; BD-2; BD2; beta 2; beta 2 Defensin; Beta defensin 2; Beta defensin 4B; Beta-defensin 2; Beta-defensin 4A; DEF B2; DEF B4; DEFB 102; DEFB 2; DEFB 4; DEFB102; DEFB2; DEFB2; formerly; DEFB4; DEFB4; formerly; DEFB4B; DEFB4P; Defensin; Defensin beta 2; Defensin; beta 4; Defensin; beta 4; pseudogene; Defensin; beta 4A; Defensin; beta 4B; Defensin; beta; 2; formerly; Defensin; beta; 4; formerly; DFB4A_HUMAN; HBD 2; hBD-2; HBD2; mBD-2; SAP 1; SAP1; Skin antimicrobial peptide 1; Skin-antimicrobial peptide 1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-64aa
Target Protein Sequence
MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKC CKKP
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
31.3kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Exhibits antimicrobial activity against Gram-negative bacteria and Gram-positive bacteria. May act as a ligand for C-C chemokine receptor CCR6. Can bind to both human and mouse CCR6 and induce chemotactic activity of CCR6-expressing cells.
Gene References into Functions
  1. The encoded peptide has antimicrobial activity against E.coli, S. aureus, and P. aeruginosa. PMID: 9727055
Subcellular Location
Secreted.
Protein Families
Beta-defensin family, LAP/TAP subfamily
Tissue Specificity
Expressed in the skin and respiratory tract.
Database Links

HGNC: 2767

OMIM: 602215

KEGG: hsa:100289462

STRING: 9606.ENSP00000424598

UniGene: Hs.105924

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*