Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Cardiovascular
Alternative Names
RHD; Blood group Rh(D polypeptide; RHXIII; Rh polypeptide 2; RhPII; Rhesus D antigen; CD antigen CD240D
Species
Homo sapiens (Human)
Expression Region
388-417aa
Target Protein Sequence
LNLKIWKAPHEAKYFDDQVFWKFPHLAVGF
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 6xHis-GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The N-terminal 6xHis-GST tag was fused to the gene fragment corresponding to the 388-417aa of the human RHD protein and then was cloned into an expression vector. The expression vector was transformed into the E.coli for expression. The generated product was purified and separated to obtain the recombinant human RHD protein. Its purity is higher than 85%. It showed an apparent molecular weight of about 34 kDa under SDS-PAGE condition.This recombinant human RHD protein may be used in cardiovascular research.
RHD is a gene encoding a protein named blood group Rh(D) polypeptide and belongs Rh subfamily which consist of RHD, RHCE, RhAG, RhBG, and RhCG. RHD has sequence similarity to others and is restricted to tissues or cell lines expressing erythroid characters. It was proposed that the erythrocyte Rh complex is a heterotrimer of RhAG, RhD, and RhCE protein subunits. Diseases associated with RHD include Hemolytic Disease Of Fetus And Newborn, Rh-Induced and Blood Group, Rh System.