Recombinant Human Blood group Rh(D) polypeptide(RHD),partial


In Stock
Code CSB-EP019677HU
Product Type Recombinant Protein
Size US$2466
Uniprot No. Q02161
Relevance May be part of an oligomeric complex which is likely to have a transport or channel function in the erythrocyte membrane.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence LNLKIWKAPHEAKYFDDQVFWKFPHLAVGF
Research Area Cardiovascular
Source E.coli
Gene Names RHD
Protein Names RHXIIIRh polypeptide 2Short name:RhPIIRhesus D antigenCD_antigen: CD240D
Expression Region 388-417aa
Tag Info N-terminal 6xHis-GST-tagged
Mol. Weight 33.6 kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May be part of an oligomeric complex which is likely to have a transport or channel function in the erythrocyte membrane.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families Ammonium transporter (TC 2.A.49) family, Rh subfamily
Tissue Specificity Restricted to tissues or cell lines expressing erythroid characters.
Database Links

HGNC: 10009

OMIM: 111680

KEGG: hsa:6007

STRING: 9606.ENSP00000331871

UniGene: Hs.449968

Related Products

RHD Antibodies

RHD Antibodies for Homo sapiens (Human)

RHD Antibodies for Human

RHD Proteins

RHD Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.