Recombinant Human Bone morphogenetic protein 6 (BMP6), partial

In Stock
Code CSB-EP002742HU1
Abbreviation Recombinant Human BMP6 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Developmental Biology
Alternative Names
BMP-6; Bmp6; BMP6_HUMAN; Bone morphogenetic protein 6; Bone Morphogenic Protein 6; Decapentaplegic vegetal related; DVR6; HGNC:12686; TGFB related vegetal related growth factor; Transforming growth factor beta; Vegetal related (TGFB related) cytokine; Vegetal related growth factor (TGFB related); Vg related sequence; VG-1-R; VG-1-related protein; Vg1 related sequence; VGR; VGR-1; VGR1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
382-513aa
Target Protein Sequence
QQSRNRSTQSQDVARVSSASDYNSSELKTACRKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAPTKLNAISVLYFDDNSNVILKKYRNMVVRACGCH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
18.9kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Amino acids 382-513 form the expressed segment for recombinant Human BMP6. This BMP6 protein is theoretically predicted to have a molecular weight of 18.9 kDa. This protein is generated in a e.coli-based system. The N-terminal 6xHis tag was fused into the coding gene segment of BMP6, making it easier to detect and purify the BMP6 recombinant protein in the later stages of expression and purification.

The human bone morphogenetic protein 6 (BMP6) is a member of the transforming growth factor-beta (TGF-β) superfamily. BMP6 plays a pivotal role in bone and cartilage development, as well as in various other cellular processes. BMP6 is known for its involvement in osteogenesis, promoting the differentiation of mesenchymal stem cells into osteoblasts, which are responsible for bone formation. Additionally, BMP6 participates in iron homeostasis, acting as a key regulator of hepcidin, a peptide hormone that controls iron absorption and distribution. Research on BMP6 spans multiple areas, including skeletal biology, regenerative medicine, and iron metabolism.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Growth factor of the TGF-beta superfamily that plays essential roles in many developmental processes including cartilage and bone formation. Plays also an important role in the regulation of iron metabolism by acting as a ligand for hemojuvelin/HJV. Initiates the canonical BMP signaling cascade by associating with type I receptor ACVR1 and type II receptor ACVR2B. In turn, ACVR1 propagates signal by phosphorylating SMAD1/5/8 that travel to the nucleus and act as activators and repressors of transcription of target. Can also signal through non-canonical pathway such as TAZ-Hippo signaling cascade to modulate VEGF signaling by regulating VEGFR2 expression.
Gene References into Functions
  1. The present study demonstrated that BMP6 may protect retinal pigment epithelial cells from oxidative stress injury to a certain extent, which may be associated with alterations in the MAPK signaling pathway. PMID: 29767257
  2. Study demonstrated that the mesenchymal epithelial/myoepithelial potential of transdifferentiation of the luminal cells that make up the proliferative units is certified by the immunohistochemical expression of some BMP6 purely mesenchymal protein cells. PMID: 28523310
  3. Plasma BMP6 was significantly increased in chronic heart failure patients. PMID: 27592865
  4. Our results independently add further evidence to the role of BMP6 mutations as likely contributing factors to late-onset moderate IO unrelated to mutations in the established five HH genes. PMID: 28335084
  5. Further investigation on clinical ESCC samples and non-tumorous adjacent tissue found that tumors with triple-positive BMP6, ALK2 and BMPRII had deeper growth than tumors with only BMP6 expression PMID: 27959431
  6. the combined delivery of VEGF and BMP-6 to the bone defect significantly enhanced bone repair through the enhancement of angiogenesis and the differentiation of endogenously recruited MSCs into the bone repair site. PMID: 26475719
  7. the patients carried genotype TA of rs 267196 and genotype AG of rs267201 present a high risk factor for developing osteonecrosis RR=1.317 and RR=1.3 respectively PMID: 24263212
  8. BMP-6 upregulates somatostatin receptor actions, leading to reduction of GnRH-induced secretion of luteinizing hormone. PMID: 26779985
  9. These observations suggest a novel role of BMP-6 in the inhibition of breast cancer metastasis by regulating secretion of MMPs(MMP-1) in the tumor microenvironment. PMID: 26751737
  10. BMP-dependent physical interaction of VE-cadherin with the BMP receptor ALK2 (BMPRI) and BMPRII, resulting in stabilization of the BMP receptor complex and, thereby, the support of BMP6-Smad signaling. PMID: 26598555
  11. BMP6 and oxidized low-density lipoprotein independently and synergistically induced osteogenic differentiation and mineralization in vascular endothelial cells. PMID: 26410368
  12. Identify 3 heterozygous missense mutations in BMP6 in patients with unexplained iron overload. These mutations lead to loss of signaling to SMAD proteins and reduced hepcidin production. PMID: 26582087
  13. These results demonstrated that Hcy up-regulated hepcidin expression through the BMP6/SMAD pathway, suggesting a novel mechanism underlying the hyperhomocysteinemia-associated perturbation of iron homeostasis. PMID: 26855134
  14. demonstrate that BMP6 is associated with radiographic severity in AS, supporting the role wingless-type like/BMP pathway on radiographic progression in AS PMID: 25121767
  15. These observations imply that crosstalk between the VEGF and BMP-6 signaling pathways enhances osteogenic differentiation of MSCs. PMID: 25753222
  16. In vitro analysis revealed that recombinant BMP6 inhibited the activation of hepatic stellate cells (HSCs) and reduced proinflammatory and profibrogenic gene expression in already activated HSCs PMID: 25011936
  17. CpG island methylation of BMP6 is found in high frequency in CRC and this epigenetic event is associated with suppressed protein expression in the tumor tissue. PMID: 25227796
  18. BMP-6 attracted neutrophils and controlled the regulation of the neutrophils in the ovary. PMID: 24406789
  19. Data indicated that hypermethylation modifications contributed to the regulation of BMP6 and induced an epithelial-to-mesenchymal transition phenotype of breast cancer during the acquisition of drug resistance. PMID: 24890613
  20. BMP-6 secreted by prostate cancer cells induces IL-6 expression in macrophages; IL-6, in turn, stimulates the neuroendocrine differentiation of prostate cancer cells. PMID: 21374653
  21. these data highlight a therapeutically innovative role for BMP6 by providing a means to enhance the amount of myogenic lineage derived brown fat. PMID: 24658703
  22. There were no correlations between iron parameters and the expression of the BMP-6 in granulosa cells from polycycstic ovary syndrome patients. PMID: 24875397
  23. The BMP-6 staining intensity was downregulated. PMID: 24498236
  24. WNT5A derived from bone stromal cells induced the expression of BMP-6 by CaP cells; BMP-6 in turn stimulated cellular proliferation of CaP cells. PMID: 24518599
  25. Marker gene screening for human mesenchymal stem cells in early osteogenic response to bone morphogenetic protein 6 with DNA microarray. PMID: 23799295
  26. Prostate cancer-derived BMP-6 stimulates tumor-associated macrophages to produce IL-1a through a crosstalk between Smad1 and NF-kB1; IL-1a, in turn, promotes angiogenesis and prostate cancer growth. PMID: 24185914
  27. High BMP6 expression is associated with breast cancer. PMID: 24012720
  28. BMP6 plays a critical role in breast cancer cell aberrant proliferation and chemoresistance and may serve as a novel diagnostic biomarker or therapeutic target for breast cancer. PMID: 23674072
  29. Estrogen is involved in hepcidin expression via a GPR30-BMP6-dependent mechanism PMID: 22792339
  30. investigated role of BMP6 in esophageal squamous cell carcinoma (SCC) development and progression;high BMP6 activity, defined by strong BMP6 expression with weak noggin or SOST expression, was associated with shorter survival in esophageal SCC patients; results suggest BMP6, noggin and SOST could be used in combination as a prognostic indicator in cancer progression PMID: 22364398
  31. Results suggest that PTHrP (ParaThyroid Hormone-related Protein) acts upstream of BMP-6, and exerts its antimitogenic effect by reducing BMP-6 mRNA expression through PKA signaling pathway in breast cancer cells. PMID: 20401668
  32. The methylation of BMP6 was correlated with decreased levels of mRNA transcripts. PMID: 22086350
  33. Growth differentiation factor 3 is induced by bone morphogenetic protein 6 (BMP-6) and BMP-7 and increases luteinizing hormone receptor messenger RNA expression in human granulosa cells. PMID: 22305102
  34. BMP-6 mainly inhibited plasmablast differentiation, and BMP-7 mainly induced apoptosis in human memory B cells PMID: 21898381
  35. BMP6 and iron not only induce hepcidin expression but also induce TMPRSS6, a negative regulator of hepcidin expression PMID: 21622652
  36. a novel role of BMP-6/HO-1 cascade to relieve breast cancer metastasis by regulating the secretion of growth factors in tumor microenvironment. PMID: 21136273
  37. AGTR1 gene deletion is associated with congenital anomalies of the kidneys and urinary tract. PMID: 20605837
  38. the cBMP6 mRNA and H3K27me3 levels revealed significant differences between patients with local local advanced, or metastatic disease PMID: 20573596
  39. Ass-associated increases in BMP6 expression in a transgenic mouse model of Alzheimer's disease may have deleterious effects on neurogenesis in the hippocampus. PMID: 20844121
  40. BMP6, Smad1, Smad2 mRNA and protein expression were significantly higher in during sickle-cell pathology with orthopedic complications. PMID: 20460105
  41. Using BMP-6/7 chimeras, we identified lysine 60 as a key residue conferring noggin resistance within the BMP-6 protein. PMID: 20048150
  42. Malignant human clear cell renal carcinoma tissue had significantly higher BMP-6 mRNA expression than healthy tissue PMID: 20016212
  43. regulates hepcidin an iron metabolism in humans PMID: 19765379
  44. the presence of BMP-6 in adult human articular cartilage indicates a functional role for this growth factor in the maintenance of joint integrity. PMID: 13130469
  45. BMP-6 increases the levels of osteopontin, BMP-2, alkaline phosphatase and core binding factor alpha 1 mRNAs in human periodontal (HPL) ligament cells. PMID: 15516325
  46. Recombinant noggin inhibited the function of BMP-6, suggesting a negative feedback regulation of BMP activity and indicating a strategy for the development of a novel therapeutic target in treatment of osteosclerotic bone metastases of prostate cancer PMID: 15548695
  47. several single nucleotide polymorphisms in bone morphogenic protein 6, annexin A2, and klotho were associated with sickle cell osteonecrosis PMID: 15784727
  48. In mature human B cells, BMP-6 inhibited cell growth, and rapidly induced phosphorylation of Smad1/5/8 followed by an upregulation of Id1. PMID: 15877825
  49. endogenous BMP-6 system plays critical roles in aldosterone production between Ang II and K through ERK signaling pathway. PMID: 16527843
  50. Excess numbers of BMP6-deficient myofibroblast progenitor cells may favour adverse tissue remodelling in patients with diabetes. PMID: 16547600

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
TGF-beta family
Database Links

HGNC: 1073

OMIM: 112266

KEGG: hsa:654

STRING: 9606.ENSP00000283147

UniGene: Hs.285671

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*